Entry information : Zm1CysPrx (PER1 / PER-1 / GRMZM2G129761[6a])
Entry ID 4964
Creation 2009-01-15 (Christophe Dunand)
Last sequence changes 2009-01-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-07-08 (Christophe Dunand)
Peroxidase information: Zm1CysPrx (PER1 / PER-1 / GRMZM2G129761[6a])
Name (synonym) Zm1CysPrx (PER1 / PER-1 / GRMZM2G129761[6a])
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation Nucleus
Tissue types Aleurone
Embryos
Endosperm
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Zm1CysPrx
start..stop
S start..stop
Sb1CysPrx01 426 3e-154 1..229 1..222
Hv1CysPrx 390 4e-140 1..229 1..218
Ta1CysPrx01-2D 387 4e-139 1..229 1..218
Asp1CysPrx01-B 387 6e-139 1..229 1..218
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 168785684..168785801 118 N° 2 168785886..168786457 572  
join(168785684..168785801,168785886..168786457)


exon

Literature and cross-references Zm1CysPrx (PER1 / PER-1 / GRMZM2G129761[6a])
Literature Chen,Z.-Y., Brown,R.L., Damann,K.E. and Cleveland,T.E. Comparisons of endosperm proteins of domestic corn genotypes resistant or susceptible to Aspergillus flavus infection/aflatoxin production using proteomics. Unpublished. Submitted (26-JAN-2006)
Protein ref. UniProtKB:   A2SZW8
DNA ref. GenBank:   AC212733.4 (25916..26686)
mRNA ref. GenBank:   DQ378060
Cluster/Prediction ref. UniGene:   Zm.11291
Protein sequence: Zm1CysPrx (PER1 / PER-1 / GRMZM2G129761[6a])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   229
PWM (Da):   %s   24856.52  
PI (pH):   %s   6.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLTIGDTVPNLELDSTHGKIRIHDYVGDGYAIIFSHPADFTPVCTTEMAAMAGYAKEFEKRGVKLLGISCDDVESHRQWTKDVEAYGGKQQQQQHTTTKVTFPILADPARDAIRQLNMVDPDEKDAAGRSMPSRALHVVGPDKAVKLSFLYPATTGRNMDEVLRAVDSLLTAAKHGGKVATPANWKPGECAVIAPGVSDEEARKMFPQGFETADLPSKKGYLRFTKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 1 intron), 1 mRNA and 114 ESTs. Also found in AC206295.2.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGGGGCTCACCATAGGCGACACCGTCCCCAACCTGGAGCTGGACTCCACCCACGGCAAGATCCGCATCCACGACTACGTTGGCGACGGCTACGCTATCATCTTCTCTCACCCAGGT
ACGTCTGCTGCCGGTCGTCGCTCGGCCATATGCATGCCTTGCTCGCGTGCACCTGCTGATGGGAGATAAGATGATATGGCAGCCGACTTCACGCCCGTGTGCACGACGGAGATGGCGGCG
ATGGCGGGGTACGCCAAGGAGTTCGAGAAGCGTGGCGTGAAGCTGCTGGGCATCTCGTGCGACGACGTGGAGTCGCACAGGCAGTGGACCAAGGACGTGGAGGCGTACGGCGGGAAGCAG
CAGCAGCAGCAGCATACGACGACGAAGGTGACGTTCCCGATCCTGGCGGACCCGGCGCGGGACGCCATCCGGCAGCTGAACATGGTGGACCCCGACGAGAAGGACGCGGCGGGGCGGAGC
ATGCCGTCCCGCGCGCTCCACGTCGTCGGGCCCGACAAGGCCGTGAAGCTGAGCTTCCTGTACCCGGCCACCACGGGGCGGAACATGGACGAGGTGCTGCGCGCCGTCGACTCGCTGCTC
ACGGCCGCCAAGCACGGCGGGAAGGTGGCCACGCCCGCTAACTGGAAGCCCGGGGAGTGCGCCGTCATCGCGCCCGGCGTCTCCGACGAGGAGGCCAGGAAGATGTTCCCGCAGGGGTTC
GAGACCGCCGACCTGCCCTCCAAGAAGGGCTACCTCCGTTTCACCAAGGTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGGGGCTCACCATAGGCGACACCGTCCCCAACCTGGAGCTGGACTCCACCCACGGCAAGATCCGCATCCACGACTACGTTGGCGACGGCTACGCTATCATCTTCTCTCACCCAGCC
GACTTCACGCCCGTGTGCACGACGGAGATGGCGGCGATGGCGGGGTACGCCAAGGAGTTCGAGAAGCGTGGCGTGAAGCTGCTGGGCATCTCGTGCGACGACGTGGAGTCGCACAGGCAG
TGGACCAAGGACGTGGAGGCGTACGGCGGGAAGCAGCAGCAGCAGCAGCATACGACGACGAAGGTGACGTTCCCGATCCTGGCGGACCCGGCGCGGGACGCCATCCGGCAGCTGAACATG
GTGGACCCCGACGAGAAGGACGCGGCGGGGCGGAGCATGCCGTCCCGCGCGCTCCACGTCGTCGGGCCCGACAAGGCCGTGAAGCTGAGCTTCCTGTACCCGGCCACCACGGGGCGGAAC
ATGGACGAGGTGCTGCGCGCCGTCGACTCGCTGCTCACGGCCGCCAAGCACGGCGGGAAGGTGGCCACGCCCGCTAACTGGAAGCCCGGGGAGTGCGCCGTCATCGCGCCCGGCGTCTCC
GACGAGGAGGCCAGGAAGATGTTCCCGCAGGGGTTCGAGACCGCCGACCTGCCCTCCAAGAAGGGCTACCTCCGTTTCACCAAGGTTTAG

Retrieve as FASTA