Entry information : Nc1CysPrx
Entry ID 4973
Creation 2007-03-11 (Nicolas Rouhier)
Last sequence changes 2007-03-11 (Nicolas Rouhier)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-25 (Catherine Mathe (Scipio))
Peroxidase information: Nc1CysPrx
Name Nc1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora crassa    [TaxId: 5141 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Nc1CysPrx
start..stop
S start..stop
Mgr1CysPrx 405 4e-146 1..224 1..224
Pno1CysPrx02 372 6e-133 4..224 2..222
Gz1CysPrx 370 3e-132 8..224 5..221
Dh1CysPrx 341 8e-121 1..221 1..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2224627..2224652 26 N° 2 2224218..2224541 324 N° 3 2223806..2224133 328  
complement(join(2223806..2224133,2224218..2224541,2224627..2224652))


exon

Literature and cross-references Nc1CysPrx
Literature Galagan J.E. et al. The genome sequence of the filamentous fungus Neurospora crassa. Nature 422 (6934), 859-868 (2003)
Protein ref. UniProtKB:   Q7S4F4
DNA ref. JGI genome:   supercont10.7 (2224652..2223806)
mRNA ref. GenBank:   EAA30385
Protein sequence: Nc1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   225
PWM (Da):   %s   25025.99  
PI (pH):   %s   6.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTDRNAPLRLGTIAPNFQADTTTGPIDFHEFIGDNWVILFSHPEDYTPVCTTELGEMARLEPEFKKRGVKLIGLSANTLGSHEGWINDIKDVTGSQVQFPIIADKERKVAYLYDMLDYQDTTNVDEKGIAFTIRSVFVIDPKKTIRTILAYPASTGRNSAEILRIVDSLQTGDKHKVTTPINWVPGDDVIVHPSIKGEEATRLFPNLKAVKPYLRFTPLPKDA

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo VII, 2 introns). Strain="ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCACCGACCGCAACGCTCCGTAAGTCCTCGAGCCTCCTTCGTCATCACTGTCCACAAAGCTCGTTTTGCGCGGATGAACGACTGACCCGTGATTCCCAATGCAGCCTCCGCCT
GGGCACCATTGCCCCCAACTTCCAGGCTGACACCACCACGGGTCCCATTGACTTCCACGAGTTCATTGGCGACAACTGGGTCATCCTCTTCTCCCACCCCGAGGACTACACCCCCGTCTG
TACCACCGAGCTCGGCGAGATGGCCCGCCTCGAGCCCGAGTTCAAGAAGCGCGGCGTCAAGCTGATCGGTCTCTCCGCCAACACCCTCGGCAGCCACGAGGGCTGGATCAACGACATCAA
GGATGTCACCGGCTCCCAGGTCCAATTCCCCATCATTGCCGACAAGGAGCGCAAGGTTGCCTACCTCTACGACAT
GTAAGTATACCCACCACATCTCACAGATAGGGAGGGGGGTTTTGG
GGAAAGTGGGCATCGAGTTGCTGACACTCTGTTCTACAGGCTCGACTACCAGGACACCACCAACGTCGACGAGAAGGGCATCGCCTTCACCATCCGCTCCGTCTTCGTCATCGACCCCAA
GAAGACCATCCGCACCATCCTCGCGTACCCCGCCTCGACCGGCCGCAACTCCGCCGAGATCCTCCGCATCGTCGACTCCCTCCAGACCGGCGACAAGCACAAGGTCACCACCCCCATTAA
TTGGGTCCCTGGTGATGACGTTATTGTCCACCCTTCCATCAAGGGAGAGGAGGCCACCCGTCTCTTCCCCAACCTCAAGGCTGTCAAGCCCTACCTCCGCTTCACTCCCCTTCCCAAGGA
CGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCACCGACCGCAACGCTCCCCTCCGCCTGGGCACCATTGCCCCCAACTTCCAGGCTGACACCACCACGGGTCCCATTGACTTCCACGAGTTCATTGGCGACAACTGGGTCATC
CTCTTCTCCCACCCCGAGGACTACACCCCCGTCTGTACCACCGAGCTCGGCGAGATGGCCCGCCTCGAGCCCGAGTTCAAGAAGCGCGGCGTCAAGCTGATCGGTCTCTCCGCCAACACC
CTCGGCAGCCACGAGGGCTGGATCAACGACATCAAGGATGTCACCGGCTCCCAGGTCCAATTCCCCATCATTGCCGACAAGGAGCGCAAGGTTGCCTACCTCTACGACAT
GCTCGACTAC
CAGGACACCACCAACGTCGACGAGAAGGGCATCGCCTTCACCATCCGCTCCGTCTTCGTCATCGACCCCAAGAAGACCATCCGCACCATCCTCGCGTACCCCGCCTCGACCGGCCGCAAC
TCCGCCGAGATCCTCCGCATCGTCGACTCCCTCCAGACCGGCGACAAGCACAAGGTCACCACCCCCATTAATTGGGTCCCTGGTGATGACGTTATTGTCCACCCTTCCATCAAGGGAGAG
GAGGCCACCCGTCTCTTCCCCAACCTCAAGGCTGTCAAGCCCTACCTCCGCTTCACTCCCCTTCCCAAGGACGCTTAA

Retrieve as FASTA