Entry information : MtAPx05 (Medtr5g022510.1[4.0] / Medtr5g022420.1[3.0])
Entry ID 5134
Creation 2007-04-06 (Christophe Dunand)
Last sequence changes 2007-04-06 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-07-31 (Messaoudi)
Peroxidase information: MtAPx05 (Medtr5g022510.1[4.0] / Medtr5g022420.1[3.0])
Name (synonym) MtAPx05 (Medtr5g022510.1[4.0] / Medtr5g022420.1[3.0])
Class Ascorbate peroxidase    [Orthogroup: APx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation Peroxisomal
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtAPx05
start..stop
S start..stop
GmAPx06 477 9e-173 1..281 1..280
CroAPx03 434 8e-156 6..279 7..289
LsaAPx02 432 4e-155 1..279 1..283
BnAPx03-1Aa_other 427 6e-153 1..280 1..286
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8884158..8884270 113 N° 2 8883945..8884069 125 N° 3 8883793..8883842 50 N° 4 8883099..8883164 66
N° 5 8882928..8882976 49 N° 6 8882748..8882830 83 N° 7 8881985..8882064 80 N° 8 8881798..8881900 103
N° 9 8881519..8881695 177  
complement(join(8881519..8881695,8881798..8881900,8881985..8882064,8882748..8882 830,8882928..8882976,8883099..8883164,8883793..8883842,8883945..8884069,8884158. .8884270))


exon

Literature and cross-references MtAPx05 (Medtr5g022510.1[4.0] / Medtr5g022420.1[3.0])
Literature Debelle,F., Samain,S., Choisne,N., Saurat,O., Dudez,A., Gouzy,J., Barbe,V., Segurens,B., Wincker,P., Couloux,A., Scarpelli,C., Quetier,F. and Weissenbach,J. Medicago truncatula chromosome 5 sequencing
DNA ref. Phytozome 12:   chr5 (8884270..8881519)
Cluster/Prediction ref. Phytozome Gene 12:   31088214
Protein sequence: MtAPx05 (Medtr5g022510.1[4.0] / Medtr5g022420.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   281
PWM (Da):   %s   31310.21 Transmb domain:   %s   o257-276i
PI (pH):   %s   8.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKYAVDAEYVKEIEEVRRDLRSFITNKKCAPLMLRLAWHDAGTYDAKTRTGGPNGSIRNQQELNHAANKGLKTAVELEEVKVKHPKVSYADLYLAGVVAVEVTGGPTIQFVPGRKDSLESPQEGRLPDAKQGASHLREIFYRMGLTDKDIVALSGGHTGKAHKDRSNFEGQWTRDPLKFDNSYFVELMKLESNDLLKLPTDKALVDDPAFRKYVELYADENAFFRDYATSHKKLSELGFNPSCSYRSQLAKAALGMVIASTVVVLGYLLELNKKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 8 introns). No EST. Contig position: 16898-19649.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAATATGCAGTTGATGCAGAGTATGTTAAAGAAATCGAGGAGGTTCGTCGCGATCTTCGTTCTTTTATCACTAATAAAAAATGTGCTCCTCTCATGCTACGATTAGCGTACGTT
TGTTACAATAATTTCAACTTTACAAACCTTTTACTATAAAACATATACATAAATTGTATAACATATAATATTGATTTATAGGTGGCATGATGCTGGTACATACGACGCAAAAACAAGAAC
AGGGGGTCCAAATGGTTCTATCAGGAATCAACAAGAGCTGAACCATGCTGCTAACAAGGGCTTGAAAACAGCCGTTGAATTATGTG
GTCAGTAAGACAGTGATGACCTTAATTTTTGACT
TAAATTAATAATCTCCAATTTTTTGCTTATTAATCGTTATCGTTATTATTTTTTGTTTTGTGAAACAGAGGAAGTGAAGGTTAAACACCCCAAAGTTTCATATGCGGACCTTTACCAGGT
TATTTTATAACTTTTTTTTTTCTTTTCTGTAATAATTTATAATAAAGACATTAACATGTCGATTGGAGTCATGTTATGTACAAAAATGTTTCATGGACGTCGAGTTTTTCATACACTTGA
ACGTCTATAGAATCACATGCGAAAATATGATTAGTTTTTTTTGTCAAAGGTCTGACATGTAGTTAAATTAACCACAAATTTGATTATGAATTGAATTAATCCTTTATTGATCTGAATTAA
CCATATTTTTGCACATGATCAACCCAATTGTCACACATAAAAAAAAAGGGTGTTACATGTATGTATTATACTCCCTCCGTCCCAAATTGTATGACGTTTTGGGCATTTCACACACATATT
AAGAAATATAATTAATATTGTGTAGGAAAGAGATATTATGAGTTGTTTTACAAAATTGTCCTCAATAAATGATATTGGAAAGATAAATGAAGGAATTGAAAGAAGAGAGCAATAAATAGT
TAATAATATAATAGGAAAAATAATATTAATTTTTCATCGGTATTGTAAAGCGACATATAATTTGGGATGAATATTTTTTCTAAAGTGAGATACAATTTGGGACGGAGGAAGTATTATGTA
AGAAGAAATATTTGTATGTATTTCAGCTAGCTGGGGTTGTGGCTGTAGAGGTCACTGGTGGTCCAACTATTCAGTTTGTTCCCGGAAGAAAGGTACATTCATCATTCAATGCAATACTAA
TCATGCTTTGTTTAATTAGCCTCATGATTTCAGTAACAATCTATCTTTATTATACTATTATAGTAGTAATATGAGGTGTTTTATTTTGAATTAGGATTCATTGGAATCTCCACAAGAAGG
TCGCCTTCCAGATGCCAAACAAG
GTAATTAAATCATGTTGTTCAATCTTGAAACTTAACTCAAAATTACTTAAACTAAGTATTTCATTTATCATATGAAAAACTATATATTATATTTCAG

GCGCATCACATTTAAGAGAGATCTTTTATCGCATGGGTCTCACTGATAAAGACATTGTAGCTCTCTCTGGAGGCCACACTTTG
GTACAAATTAATTACCAACCATAATTCAAACACTTCC
TTTGTTTATTATATTTATGAGTAATGCTATATACCACGAAAACAACTTCTACTTGCCTTTTGTTCCTTAATTAGTTGTTCGCTTCATGATTTCTAGCTTTGTTTTTTATTTCTAGTAATT
TTAAGTAAAATAAAAAGAATTTCTAGTGTTTTGCTTTAATTAAAAAATATGATATCTAGTATTTTATATGCTTTTACCAACAAAGCAATGATAATGGGTATTTAAATCTACATATATATG
GAAGGTCCCCGTGAGCTTAACTCAGTTGATAATGACAGTGCATAATATATGTAAGGTCCGGGGTTCAAACCCAAAAACCATATTTTACATTTTAAATGTGAGTTTCAGCCACTAAATTAC
TTGACCAATTTTTTTATTTTATTTTTTTATATCGATTTAGATTTAAATACTCATCATCAAAGTCTTGTTGTTAAAAGCACATAAAATACTAAAAATTGTTTTTTTAATCACTTTTTGGTT
AAAGCAAACAACTAGAAACCATTTTTATTTATTAAAACGAATAGAAGTATAAATAAACTATAAATCATGAAGAAATCGTGTCGTACCATAAATCATTTTCCTATATTTATTCATTTGATG
AAGAATATATAAATTTAATTTAATATCGTTCATTTCAATTGATAAGGGTAAGGCACATAAAGATCGCTCTAACTTTGAAGGTCAATGGACTAGAGACCCTCTCAAGTTTGATAACTCTTA
TTTTGT
GTAAGATGATTTGTTAATTTGTTTATTTAAAATAGTGTATTATGTATGAATATTTGATATTTAATACAATATTAACATAAACAGGGAACTAATGAAATTGGAATCAAACGATTT
ATTGAAGCTTCCCACAGATAAGGCTCTAGTTGATGATCCTGCGTTCCGCAAATATGTTGAACTCTATGCTAAG
GTTTTGTCTTTACTATATATATTTTCTTTTGTTCTCTATTTTATTTT
ATACTATAGTATTATGTATTTTTGTGTGGCTAATAATGATTTTGAATTTTACTAGGATGAGAATGCATTTTTCAGAGATTATGCAACATCACACAAGAAACTCTCTGAATTAGGCTTCAA
TCCCAGTTGCAGTTATCGTTCCCAATTGGCTAAGGCAGCTTTAGGAATGGTTATTGCCTCAACTGTTGTGGTGCTGGGTTACTTACTTGAGCTGAACAAAAAAATCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAATATGCAGTTGATGCAGAGTATGTTAAAGAAATCGAGGAGGTTCGTCGCGATCTTCGTTCTTTTATCACTAATAAAAAATGTGCTCCTCTCATGCTACGATTAGCGTGGCAT
GATGCTGGTACATACGACGCAAAAACAAGAACAGGGGGTCCAAATGGTTCTATCAGGAATCAACAAGAGCTGAACCATGCTGCTAACAAGGGCTTGAAAACAGCCGTTGAATTATGTG
AG
GAAGTGAAGGTTAAACACCCCAAAGTTTCATATGCGGACCTTTACCAG
CTAGCTGGGGTTGTGGCTGTAGAGGTCACTGGTGGTCCAACTATTCAGTTTGTTCCCGGAAGAAAGGATTCA
TTGGAATCTCCACAAGAAGGTCGCCTTCCAGATGCCAAACAAG
GCGCATCACATTTAAGAGAGATCTTTTATCGCATGGGTCTCACTGATAAAGACATTGTAGCTCTCTCTGGAGGCCAC
ACTTTG
GGTAAGGCACATAAAGATCGCTCTAACTTTGAAGGTCAATGGACTAGAGACCCTCTCAAGTTTGATAACTCTTATTTTGTGGAACTAATGAAATTGGAATCAAACGATTTATTG
AAGCTTCCCACAGATAAGGCTCTAGTTGATGATCCTGCGTTCCGCAAATATGTTGAACTCTATGCTAAG
GATGAGAATGCATTTTTCAGAGATTATGCAACATCACACAAGAAACTCTCT
GAATTAGGCTTCAATCCCAGTTGCAGTTATCGTTCCCAATTGGCTAAGGCAGCTTTAGGAATGGTTATTGCCTCAACTGTTGTGGTGCTGGGTTACTTACTTGAGCTGAACAAAAAAATC
AATTGA

Retrieve as FASTA