Entry information : MtPrxQ ( Medtr4g124790.1 [4.0] / Medtr4g124790.1 [3.5])
Entry ID 5138
Creation 2007-04-06 (Christophe Dunand)
Last sequence changes 2016-05-03 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-05-11 (Christophe Dunand)
Peroxidase information: MtPrxQ ( Medtr4g124790.1 [4.0] / Medtr4g124790.1 [3.5])
Name (synonym) MtPrxQ ( Medtr4g124790.1 [4.0] / Medtr4g124790.1 [3.5])
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Seeds
Shoots
Stems
Inducers Colletotrichum inoculation
Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Mycorrhiza
Pathogen interaction
Phoma infection
Phosphate starvation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrxQ
start..stop
S start..stop
AdePrxQ 317 1e-111 1..208 1..210
SlinPrxQ 310 3e-109 32..212 8..185
PbPrxQ01 306 1e-107 4..212 2..214
PtPrxQ01 306 2e-107 4..212 2..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 51720136..51720327 192 N° 2 51720419..51720556 138 N° 3 51722423..51722512 90 N° 4 51722583..51722801 219
join(51720136..51720327,51720419..51720556,51722423..51722512,51722583..51722801 )


exon

Literature and cross-references MtPrxQ ( Medtr4g124790.1 [4.0] / Medtr4g124790.1 [3.5])
Literature Lin,S., Dixon,R., May,G., Sumner,L., Gonzales,B., Cook,D., Kim,D., Young,N., Cannon,S. and Roe,B.A. Medicago truncatula BAC Clone mth2-84a20.
DNA ref. GenBank:   AC186199 (28919..31584) Phytozome 11:   chr4 (51720136..51722801)
Cluster/Prediction ref. Phytozome Gene 11:   31107814 UniGene:   Mtr.14713
Omic ref. Gene atlas:   Mtr.10844.1.S1_at   Mtr.22013.1.S1_s_at Legoo:   Mtr.10844.1.S1_at   Mtr.22013.1.S1_s_at
Protein sequence: MtPrxQ ( Medtr4g124790.1 [4.0] / Medtr4g124790.1 [3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   212
PWM (Da):   %s   23179.95  
PI (pH):   %s   10.13
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKASLTLPTNSFPTFIHPQNISTSLTSAPFNSQFFGLKLSHSSISKTTSSPPSSFKRGFIFAKVSKGSKPPAFTLKDQDGKTVSLSKYKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYKLPFTLLSDEGNKVRKEWGVPGDFFGSLPGRETYVLDKNGVVQLVYNNQFQPEKHIDETLKLLQSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns) and 17 ESTs. Cultivar="Jemalong" and "A17".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGCTTCCCTCACTCTCCCAACCAATTCTTTCCCCACATTTATTCACCCTCAAAACATATCAACATCACTTACTTCAGCTCCATTCAATTCTCAATTTTTTGGCCTCAAGCTA
TCTCATTCTTCCATTTCCAAAACCACTTCTTCTCCACCTTCTTCATTCAAAAGAGGTTTCATTTTTGCCAAG
GTACTTTATTCACAATATACAAGTTGCTACAATATATCAGCATTACTG
TTTGTTTGTTTTCTATATGTTGAATTCATTGGCAAATGGGCAGGTGAGTAAAGGTTCAAAGCCACCGGCTTTCACTTTGAAAGACCAAGATGGCAAGACAGTGAGTCTCTCCAAGTACAA
AGGGAAACCTGTGGTTGTTTATTTCTACCCTGCTGATGAGACCCCTGGCTGTACCAAACAG
GTAAGAAGAAAGAAACACTCATTTACTCTCAATGCTGCATATTTTTGGAGTTTGGACTG
ATTCAATTTCCGGAGACCTCTGTTTGAACATCTAATCAAAATGAATGCTTCTTTAAATTTTGTAATTCATAAGTGGATATGCATTGTTAAGTGTCATTAGTAATTCTGATGCGACTATAG
TGTGTAGTACTTCCCTTGTGTTAGTTCTGGCGGACCTTTTGGGGAGTTAATTAGTTAGGTCTCAGTCAAGGGTAATAGGGTAGTATATAAACTGATGTATCCTTGTAAAGAGATAAAAGA
GTGACATTTTCATAGAATCGTTCATCAAGAGAGAAAATTGTGTGCTCAAGTGAGCAGGTTGAGATTTTCCTTTCCTACAAAGTCTTGTACATATGTTGTGTTTAACTTGATCATAGTGAT
AGAATCTAGAGCTGTAAAAATGGGCTAGCCCATTTGGACCACCCCACCAAGCCCTTTATTTTAGAATTCTGCTCTTCACCCAGCACAAAACACTTGCGCCATGCAGCCATGCTCAAAATG
TCCCTGCATTAGTTAACTAACGCAAGTGTAAAAAATACCTGACTTAATTTTTACACGCTGCATGAGTTAACTCAGGCAAAAATTAACAGATGCGTTAACTCACGCTAGTTTTCAAAACTT
CTGATCATATCACTCACGCTGATTTGACTGGAGCTTTATCACATGAAATGAATTTCTAGATTCGGTAGTATCTAAAATGAGAAAATGCAAAGTGGGCCAATGCATGAAAAGCAAAGACCA
ATTTGACTGGATCTTTAAAGAATTAACCACCACACCATGCATACAGAAACCACATGCATTCACTATTACTTATTTTACATGATGATCCTCTTTCTCTCTCATTGACCCATACATACATAC
ATACATACATACATAATACTATTAATGTCACATGTGTAAAAACTAAGTCAAGCATTTTTTACACTTGCGTTAGTTAACTAACGCAAGAGCATTTTGAACATAGCTGCAGGGCGCGAGCGA
AAAGTGTAGGTGAAGAGCAAAATTCTTTATTTTATAGAGCTTGGGCCTGAAAATTTAAGCCCATAATTTTTAGCCCGCTCAAAATACCGACTATCCTGCATGGGCCAGGGTAGCCTGTTT
CCCGTATAACCAGAGTAAAGTCACAAACTGAAACAGAAATGTTGAAATTTGATTTTAACTATTAAAAGGCCACCTTTTTTATAGACATTAACTTTCAATACTCTAACAGCCATTGCCCAG
AATATTAGTCTTGCTATCTCAACCATGCAACAATAATTTGGGCACTTGATGTGCAGTTACTGTGTGTCGAATGCAGCCACAACATCTTAGCAGTAATGCATAAAATTAAGTCAGTGCTAT
TGGGGAAATGAAAAAACATTGAATACATGTAGTGTTATTAGAGCTTGTTTTTAAGCAGGGTTTTTTAGCCCGGTTTGATAAAGCTTGAAGCCTGTGAAGGCCAGGTAGCCCGTTTTAATA
GCTCTGGTAGGGTCAACCTCAGTGAGGATGTAGAAGACCAATCTCTGAACTTCGATAAATCTTGTGTGTTAATTCTTTACCTTCTGCAATATTTCATTTCTCCACGCGTTTTAGAACTGC
TTTATCTTTTCTGTTTCAATCCACATCAGAAGAGTTCTCAAATTTTATCCAATATTTATCTACTGATTATTAGCACCTTGTCCTCTAATTCCTAACAGTAATTGTTCATGAAGGATTATG
ATATAATTAATTCCAATATGGTAAAGGCATGGAATCAGATTATGCAGAGTAGAGCAAATACAATAAACTATTTCCATCGTTCTACTTGTATAGTTAAGGAAACAATTTCATGAATTTATT
ATTGCAGGCCTGTGCTTTTAGGGATTCATATGAGAAGTTCAAGAAAGCAGGAGCAGAGGTTGTTGGGATAAGTGGAGACGATTCTTCCTCTCACAAGGTAAAACTCAGAATTTTCACTGC
ATAATATTCGTGCCAATTAATTAACCAATGCATTGCATGAAATGTAGGCATTTGCCAAGAAGTACAAACTTCCATTTACCTTGTTGAGTGATGAGGGTAACAAGGTAAGGAAAGAGTGGG
GAGTGCCTGGCGATTTCTTTGGATCATTGCCTGGGAGAGAGACTTATGTTCTTGACAAAAATGGTGTGGTTCAGCTTGTATACAACAATCAGTTCCAACCTGAAAAGCATATTGATGAGA
CCTTGAAACTACTCCAAAGCCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGCTTCCCTCACTCTCCCAACCAATTCTTTCCCCACATTTATTCACCCTCAAAACATATCAACATCACTTACTTCAGCTCCATTCAATTCTCAATTTTTTGGCCTCAAGCTA
TCTCATTCTTCCATTTCCAAAACCACTTCTTCTCCACCTTCTTCATTCAAAAGAGGTTTCATTTTTGCCAAG
GTGAGTAAAGGTTCAAAGCCACCGGCTTTCACTTTGAAAGACCAAGAT
GGCAAGACAGTGAGTCTCTCCAAGTACAAAGGGAAACCTGTGGTTGTTTATTTCTACCCTGCTGATGAGACCCCTGGCTGTACCAAACAG
GCCTGTGCTTTTAGGGATTCATATGAGAAG
TTCAAGAAAGCAGGAGCAGAGGTTGTTGGGATAAGTGGAGACGATTCTTCCTCTCACAAG
GCATTTGCCAAGAAGTACAAACTTCCATTTACCTTGTTGAGTGATGAGGGTAACAAGGTA
AGGAAAGAGTGGGGAGTGCCTGGCGATTTCTTTGGATCATTGCCTGGGAGAGAGACTTATGTTCTTGACAAAAATGGTGTGGTTCAGCTTGTATACAACAATCAGTTCCAACCTGAAAAG
CATATTGATGAGACCTTGAAACTACTCCAAAGCCTTTAA

Retrieve as FASTA