Entry information : MtPrxQ ( Medtr4g124790.1 [4.0] / Medtr4g124790.1 [3.5])
Entry ID 5138
Creation 2007-04-06 (Christophe Dunand)
Last sequence changes 2016-05-03 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-05-11 (Christophe Dunand)
Peroxidase information: MtPrxQ ( Medtr4g124790.1 [4.0] / Medtr4g124790.1 [3.5])
Name (synonym) MtPrxQ ( Medtr4g124790.1 [4.0] / Medtr4g124790.1 [3.5])
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Seeds
Shoots
Stems
Inducers Colletotrichum inoculation
Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Mycorrhiza
Pathogen interaction
Phoma infection
Phosphate starvation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrxQ
start..stop
S start..stop
AdePrxQ 317 1e-111 1..208 1..210
SlinPrxQ 310 3e-109 32..212 8..185
PbPrxQ01 306 1e-107 4..212 2..214
PtPrxQ01 306 1e-107 4..212 2..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 51720136..51720327 192 N° 2 51720419..51720556 138 N° 3 51722423..51722512 90 N° 4 51722583..51722801 219
join(51720136..51720327,51720419..51720556,51722423..51722512,51722583..51722801 )


exon

Literature and cross-references MtPrxQ ( Medtr4g124790.1 [4.0] / Medtr4g124790.1 [3.5])
Literature Lin,S., Dixon,R., May,G., Sumner,L., Gonzales,B., Cook,D., Kim,D., Young,N., Cannon,S. and Roe,B.A. Medicago truncatula BAC Clone mth2-84a20.
DNA ref. GenBank:   AC186199 (28919..31584) Phytozome 11:   chr4 (51720136..51722801)
Cluster/Prediction ref. Phytozome Gene 11:   31107814 UniGene:   Mtr.14713
Omic ref. Gene atlas:   Mtr.10844.1.S1_at   Mtr.22013.1.S1_s_at Legoo:   Mtr.10844.1.S1_at   Mtr.22013.1.S1_s_at
Protein sequence: MtPrxQ ( Medtr4g124790.1 [4.0] / Medtr4g124790.1 [3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 212
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
23179.95  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
10.13
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKASLTLPTNSFPTFIHPQNISTSLTSAPFNSQFFGLKLSHSSISKTTSSPPSSFKRGFIFAKVSKGSKPPAFTLKDQDGKTVSLSKYKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYKLPFTLLSDEGNKVRKEWGVPGDFFGSLPGRETYVLDKNGVVQLVYNNQFQPEKHIDETLKLLQSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns) and 17 ESTs. Cultivar="Jemalong" and "A17".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGCTTCCCTCACTCTCCCAACCAATTCTTTCCCCACATTTATTCACCCTCAAAACATATCAACATCACTTACTTCAGCTCCATTCAATTCTCAATTTTTTGGCCTCAAGCTA
TCTCATTCTTCCATTTCCAAAACCACTTCTTCTCCACCTTCTTCATTCAAAAGAGGTTTCATTTTTGCCAAG
GTACTTTATTCACAATATACAAGTTGCTACAATATATCAGCATTACTG
TTTGTTTGTTTTCTATATGTTGAATTCATTGGCAAATGGGCAGGTGAGTAAAGGTTCAAAGCCACCGGCTTTCACTTTGAAAGACCAAGATGGCAAGACAGTGAGTCTCTCCAAGTACAA
AGGGAAACCTGTGGTTGTTTATTTCTACCCTGCTGATGAGACCCCTGGCTGTACCAAACAG
GTAAGAAGAAAGAAACACTCATTTACTCTCAATGCTGCATATTTTTGGAGTTTGGACTG
ATTCAATTTCCGGAGACCTCTGTTTGAACATCTAATCAAAATGAATGCTTCTTTAAATTTTGTAATTCATAAGTGGATATGCATTGTTAAGTGTCATTAGTAATTCTGATGCGACTATAG
TGTGTAGTACTTCCCTTGTGTTAGTTCTGGCGGACCTTTTGGGGAGTTAATTAGTTAGGTCTCAGTCAAGGGTAATAGGGTAGTATATAAACTGATGTATCCTTGTAAAGAGATAAAAGA
GTGACATTTTCATAGAATCGTTCATCAAGAGAGAAAATTGTGTGCTCAAGTGAGCAGGTTGAGATTTTCCTTTCCTACAAAGTCTTGTACATATGTTGTGTTTAACTTGATCATAGTGAT
AGAATCTAGAGCTGTAAAAATGGGCTAGCCCATTTGGACCACCCCACCAAGCCCTTTATTTTAGAATTCTGCTCTTCACCCAGCACAAAACACTTGCGCCATGCAGCCATGCTCAAAATG
TCCCTGCATTAGTTAACTAACGCAAGTGTAAAAAATACCTGACTTAATTTTTACACGCTGCATGAGTTAACTCAGGCAAAAATTAACAGATGCGTTAACTCACGCTAGTTTTCAAAACTT
CTGATCATATCACTCACGCTGATTTGACTGGAGCTTTATCACATGAAATGAATTTCTAGATTCGGTAGTATCTAAAATGAGAAAATGCAAAGTGGGCCAATGCATGAAAAGCAAAGACCA
ATTTGACTGGATCTTTAAAGAATTAACCACCACACCATGCATACAGAAACCACATGCATTCACTATTACTTATTTTACATGATGATCCTCTTTCTCTCTCATTGACCCATACATACATAC
ATACATACATACATAATACTATTAATGTCACATGTGTAAAAACTAAGTCAAGCATTTTTTACACTTGCGTTAGTTAACTAACGCAAGAGCATTTTGAACATAGCTGCAGGGCGCGAGCGA
AAAGTGTAGGTGAAGAGCAAAATTCTTTATTTTATAGAGCTTGGGCCTGAAAATTTAAGCCCATAATTTTTAGCCCGCTCAAAATACCGACTATCCTGCATGGGCCAGGGTAGCCTGTTT
CCCGTATAACCAGAGTAAAGTCACAAACTGAAACAGAAATGTTGAAATTTGATTTTAACTATTAAAAGGCCACCTTTTTTATAGACATTAACTTTCAATACTCTAACAGCCATTGCCCAG
AATATTAGTCTTGCTATCTCAACCATGCAACAATAATTTGGGCACTTGATGTGCAGTTACTGTGTGTCGAATGCAGCCACAACATCTTAGCAGTAATGCATAAAATTAAGTCAGTGCTAT
TGGGGAAATGAAAAAACATTGAATACATGTAGTGTTATTAGAGCTTGTTTTTAAGCAGGGTTTTTTAGCCCGGTTTGATAAAGCTTGAAGCCTGTGAAGGCCAGGTAGCCCGTTTTAATA
GCTCTGGTAGGGTCAACCTCAGTGAGGATGTAGAAGACCAATCTCTGAACTTCGATAAATCTTGTGTGTTAATTCTTTACCTTCTGCAATATTTCATTTCTCCACGCGTTTTAGAACTGC
TTTATCTTTTCTGTTTCAATCCACATCAGAAGAGTTCTCAAATTTTATCCAATATTTATCTACTGATTATTAGCACCTTGTCCTCTAATTCCTAACAGTAATTGTTCATGAAGGATTATG
ATATAATTAATTCCAATATGGTAAAGGCATGGAATCAGATTATGCAGAGTAGAGCAAATACAATAAACTATTTCCATCGTTCTACTTGTATAGTTAAGGAAACAATTTCATGAATTTATT
ATTGCAGGCCTGTGCTTTTAGGGATTCATATGAGAAGTTCAAGAAAGCAGGAGCAGAGGTTGTTGGGATAAGTGGAGACGATTCTTCCTCTCACAAGGTAAAACTCAGAATTTTCACTGC
ATAATATTCGTGCCAATTAATTAACCAATGCATTGCATGAAATGTAGGCATTTGCCAAGAAGTACAAACTTCCATTTACCTTGTTGAGTGATGAGGGTAACAAGGTAAGGAAAGAGTGGG
GAGTGCCTGGCGATTTCTTTGGATCATTGCCTGGGAGAGAGACTTATGTTCTTGACAAAAATGGTGTGGTTCAGCTTGTATACAACAATCAGTTCCAACCTGAAAAGCATATTGATGAGA
CCTTGAAACTACTCCAAAGCCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGCTTCCCTCACTCTCCCAACCAATTCTTTCCCCACATTTATTCACCCTCAAAACATATCAACATCACTTACTTCAGCTCCATTCAATTCTCAATTTTTTGGCCTCAAGCTA
TCTCATTCTTCCATTTCCAAAACCACTTCTTCTCCACCTTCTTCATTCAAAAGAGGTTTCATTTTTGCCAAG
GTGAGTAAAGGTTCAAAGCCACCGGCTTTCACTTTGAAAGACCAAGAT
GGCAAGACAGTGAGTCTCTCCAAGTACAAAGGGAAACCTGTGGTTGTTTATTTCTACCCTGCTGATGAGACCCCTGGCTGTACCAAACAG
GCCTGTGCTTTTAGGGATTCATATGAGAAG
TTCAAGAAAGCAGGAGCAGAGGTTGTTGGGATAAGTGGAGACGATTCTTCCTCTCACAAG
GCATTTGCCAAGAAGTACAAACTTCCATTTACCTTGTTGAGTGATGAGGGTAACAAGGTA
AGGAAAGAGTGGGGAGTGCCTGGCGATTTCTTTGGATCATTGCCTGGGAGAGAGACTTATGTTCTTGACAAAAATGGTGTGGTTCAGCTTGTATACAACAATCAGTTCCAACCTGAAAAG
CATATTGATGAGACCTTGAAACTACTCCAAAGCCTTTAA

Retrieve as FASTA