Entry information : GmPrx28 (Glyma13g42140.1)
Entry ID 514
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx28 (Glyma13g42140.1)
Name (synonym) GmPrx28 (Glyma13g42140.1)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Germinating shoots
Roots
Seedling cotyledons
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx28
start..stop
S start..stop
GmPrx254 669 0 1..338 1..338
MtPrx60 512 0 1..334 1..336
LjPrx22 504 0 1..334 1..334
PpePrx77 469 1e-167 9..334 14..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42226874..42227113 240 N° 2 42227194..42227376 183 N° 3 42227461..42227620 160 N° 4 42227984..42228420 437
join(42226874..42227113,42227194..42227376,42227461..42227620,42227984..42228420 )


exon

Literature and cross-references GmPrx28 (Glyma13g42140.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm13 (42226874..42228420)
EST ref. GenBank:   CX548974 [Fragment]
Protein sequence: GmPrx28 (Glyma13g42140.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340
PWM (Da):   %s   37716.94  
PI (pH):   %s   8.64
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRVMCVGFPLVALVVVSMCYGLADAEVKTPNLRWHYYKVTNRCHDAEEYVRHQVNLFWKNDRSITAKLLRLVYADCFVTGCDASILLDEGANPEKKAAQNRGLGGFAVIDKIKAVLESRCPGTVSCADILHLATRDAVKLAGGAGYPVLTGRKDGMKSDAASVDLPSPSVSLQKVLEYFKSRNLNELDMTTLLGAHTMGRTHCSFIVDRLYNYNGSGKPDPSMSVTSLESLRKLCPPRKKGQADPLVHLNPESGSSYNFTESYYRRVLSHEAVLGVDQQLLYSDDTKQISEEFAVGFEDFRKSFATSMYKMGNYRVLTGNQGEIRRYCRYTNKGNPNK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 7 ESTs. Containing motif 'YADC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGAGTTATGTGTGTGGGTTTTCCACTGGTAGCTCTCGTAGTGGTGAGCATGTGTTATGGATTGGCAGATGCAGAGGTGAAAACACCAAATTTGCGGTGGCATTATTATAAGGTG
ACGAATAGATGTCACGACGCAGAGGAGTATGTCCGGCACCAAGTGAACCTGTTTTGGAAGAATGACAGAAGCATTACAGCAAAGCTTCTCCGCTTGGTTTATGCTGACTGTTTTGTCACT
GTATGTACTATACTTTCTAGTTAGGTGTTTTGTGACTTAGCTTTCAGCAAAATATATATAATTAATGTTTTGTGGGCTAGGGATGTGATGCATCAATTCTGCTTGACGAAGGAGCAAATC
CAGAGAAAAAAGCAGCACAAAACCGGGGGCTTGGAGGATTTGCGGTCATTGACAAGATAAAAGCTGTTCTGGAATCACGATGCCCTGGAACTGTGTCTTGTGCTGATATACTCCACCTCG
CCACCAGGGATGCTGTTAAACTG
GTACACTTCTATTCTATCAACTCCTTATTCCACCAGCCCCTCCATATATACCAAACTCATTTCAGGATTCATATATGTGAACAGGCAGGTGGAGCAG
GTTACCCAGTTTTAACAGGTAGAAAGGATGGCATGAAATCAGATGCTGCATCAGTAGACCTGCCATCACCATCCGTCTCGCTGCAGAAAGTCCTGGAATATTTCAAATCCAGGAACTTGA
ATGAACTAGACATGACCACACTTTTAG
GTAAGCCAAACTTGCAATCCACTACAAATTATACTAACTAGTTGTAATACTGCTACGTTTACGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCACTGTAAATTGTGTTCTTGAGATATTCTATATATTTTTTATTAAAACTAAGCATGTTAAAAATATTCGTTCAAATCTCT
TTTACTAGTATAGATAAATAAATAGTGTTTCTAGTTGCCTTTAAGGCACCCATGTAAGCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTTTCTAAATTTTTTGGTTGAAA
TGAACGTGTGTTTGCTTCATATCAACACAGGAGCACACACAATGGGCAGAACACATTGTAGCTTTATTGTTGATCGGCTCTACAACTACAATGGTTCCGGAAAACCCGACCCAAGCATGA
GTGTTACTTCACTAGAGTCGTTGAGAAAACTTTGCCCGCCAAGAAAGAAGGGACAAGCAGACCCTCTGGTACACCTAAACCCAGAATCAGGGTCAAGTTACAACTTCACAGAATCATACT
ACAGAAGGGTCCTATCCCACGAAGCTGTCCTTGGAGTTGATCAACAATTACTATATAGTGATGACACTAAACAGATCTCCGAGGAGTTCGCTGTTGGATTTGAAGATTTTCGGAAATCTT
TTGCTACATCAATGTACAAGATGGGGAATTACAGGGTTTTAACAGGCAACCAAGGAGAGATACGCCGATATTGCCGATACACAAATAAGGGCAACCCAAATAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGAGTTATGTGTGTGGGTTTTCCACTGGTAGCTCTCGTAGTGGTGAGCATGTGTTATGGATTGGCAGATGCAGAGGTGAAAACACCAAATTTGCGGTGGCATTATTATAAGGTG
ACGAATAGATGTCACGACGCAGAGGAGTATGTCCGGCACCAAGTGAACCTGTTTTGGAAGAATGACAGAAGCATTACAGCAAAGCTTCTCCGCTTGGTTTATGCTGACTGTTTTGTCACT
GGATGTGATGCATCAATTCTGCTTGACGAAGGAGCAAATCCAGAGAAAAAAGCAGCACAAAACCGGGGGCTTGGAGGATTTGCGGTCATTGACAAGATAAAAGCTGTTCTGGAATCACGA
TGCCCTGGAACTGTGTCTTGTGCTGATATACTCCACCTCGCCACCAGGGATGCTGTTAAACTG
GCAGGTGGAGCAGGTTACCCAGTTTTAACAGGTAGAAAGGATGGCATGAAATCAGAT
GCTGCATCAGTAGACCTGCCATCACCATCCGTCTCGCTGCAGAAAGTCCTGGAATATTTCAAATCCAGGAACTTGAATGAACTAGACATGACCACACTTTTAG
GAGCACACACAATGGGC
AGAACACATTGTAGCTTTATTGTTGATCGGCTCTACAACTACAATGGTTCCGGAAAACCCGACCCAAGCATGAGTGTTACTTCACTAGAGTCGTTGAGAAAACTTTGCCCGCCAAGAAAG
AAGGGACAAGCAGACCCTCTGGTACACCTAAACCCAGAATCAGGGTCAAGTTACAACTTCACAGAATCATACTACAGAAGGGTCCTATCCCACGAAGCTGTCCTTGGAGTTGATCAACAA
TTACTATATAGTGATGACACTAAACAGATCTCCGAGGAGTTCGCTGTTGGATTTGAAGATTTTCGGAAATCTTTTGCTACATCAATGTACAAGATGGGGAATTACAGGGTTTTAACAGGC
AACCAAGGAGAGATACGCCGATATTGCCGATACACAAATAAGGGCAACCCAAATAAGTAG

Retrieve as FASTA