Entry information : MtDiOx02 (Medtr8g106800.1[4.0])
Entry ID 5140
Creation 2007-04-06 (Christophe Dunand)
Last sequence changes 2007-04-06 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-20 (Catherine Mathe)
Peroxidase information: MtDiOx02 (Medtr8g106800.1[4.0])
Name (synonym) MtDiOx02 (Medtr8g106800.1[4.0])
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtDiOx02
start..stop
S start..stop
PtDiOx02 1028 0 1..629 1..629
CclDiOx01 1017 0 1..629 1..630
CsDiOx01 1013 0 1..629 1..630
EcamDiOx01 1006 0 4..629 5..629
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45087383..45087475 93 N° 2 45087633..45087893 261 N° 3 45087997..45088146 150 N° 4 45088368..45088501 134
N° 5 45088776..45088989 214 N° 6 45089079..45089224 146 N° 7 45089327..45089554 228 N° 8 45089670..45089872 203
N° 9 45089958..45090201 244 N° 10 45090288..45090504 217  
join(45087383..45087475,45087633..45087893,45087997..45088146,45088368..45088501 ,45088776..45088989,45089079..45089224,45089327..45089554,45089670..45089872,450 89958..45090201,45090288..45090504)


exon

Literature and cross-references MtDiOx02 (Medtr8g106800.1[4.0])
Literature Lin,S., Dixon,R., May,G., Sumner,L., Gonzales,B., Cook,D., Kim,D. and Roe,B.A. Medicago truncatula BAC Clone mth2-145c18
Protein ref. UniProtKB:   A4PRI0 [Fragment]
DNA ref. GenBank:   AC150743.12 (31370..34491) Phytozome 12:   chr8 (45087383..45090504)
Cluster/Prediction ref. Phytozome Gene 12:   31075389
Protein sequence: MtDiOx02 (Medtr8g106800.1[4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   629
PWM (Da):   %s   72029.48  
PI (pH):   %s   6.7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPSLFSTPFIHPGLQPLVAKMTLFDTILFYVIHFVDKIVLWHKLPVLLGAIYLGIRRHLHFRYNLLHVGGVSGNNYDTQHYAYRTPAGTCNHPDDHLIGSQGTIIGRNMPPTTLNYGLLDPHPAVVTSKLLARKSFIDTGKQFNMIACSWIQFMIHDWIDHLEDTEQVEIGVPDGYSSGCPLKTFKFFKTKKFQTGSSHMKFGFQNTRTPWWDGSVIYGNNEKGMGRVRTFKEGKLKISEDGLLEHDEKGIPVSGDVRNSWAGYSLLQALFIKEHNAVCDMLEHYPDFDDEQLYRYARLVTSAVIAKIHTIDWTVELLKTDTLLASMRINWYGFLGKKFKDSFGNILGPELSGLVGLKEPRDHGVPYSLTEEFTSVYRMHALLPEELVLRNIKPTTGEDKCPSILEKVPMTEMIGKQGEKRLSKIGMEQMLVSMGHQPCGAITLWNFPTWLRNLIAHDIDGEERPDPVDIATMVYRDRERGVARYNEFRRNMLMIPISKWEDLTDDEEVNEALKEVYDDDVEKLDLIVGLHAEKKIKGFAISETAFFIFVIMASRRLEADRFFTTNFNSKTYTNQGFEWVNKTESLKDVIDRHFPEMTKNWMTSSSAFSVWDSMPDPKKYIPLYLR

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 9 introns). No EST. Also found in AC139526.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCTTCTCTTTTCTCTACACCCTTCATTCACCCTGGTCTGCAACCTCTTGTGGCCAAAATGACCCTCTTTGATACCATACTTTTCTATGTTAGTGTTTTTGTAATTTGAGTTCAA
TTTTTGTTTAATAAGTTCAAACATTTTATTTAAGTTTCAAGCTAATTAATCAATCTTAAAATAATATATAGTGATTGTTTCATTTTTACGTGGTATGCATTATCATGATGATAATATTGA
ATTTATGTAGGTGATACATTTTGTGGACAAAATTGTGTTGTGGCATAAGCTTCCAGTGTTGTTGGGGGCAATATACTTGGGAATTAGGAGACACTTACACTTTCGTTACAATCTGTTGCA
TGTGGGAGGAGTGAGTGGCAACAATTATGATACACAACACTATGCATATCGTACTCCGGCAGGCACGTGCAACCACCCTGACGATCACTTGATCGGTAGTCAGGGAACTATCATTGGCCG
GAATATGCCTCCGACGACTTTAAATTATGGG
GTAACTAAGCCATTTAATTCTTTGATCTTATTTTATTTTGATGTCATATTAGTATCAAATTATCAATGATGATTAACTGATCATGTATA
CTATATACGTGCAGCTGTTAGACCCTCACCCTGCAGTGGTGACCTCGAAGCTTCTAGCAAGAAAGAGCTTCATAGACACAGGGAAGCAATTCAACATGATAGCTTGTTCATGGATACAGT
TCATGATTCATGATTGGATTGATCATTTGGAGGACACTGAACAG
GTCCAATATTTATTAATTATATATGACTGTCACAATCTTATGTTAATTATATTTTTGTTTTTCCTTTTATATATTA
CCCGAATCTAAACATACATAGCTGAATAATTTACTGAATGGTGAAGTGAATGTGAATTTTACACTAATTTTGCCAACCGATTCTCCAATATTTTTTGTACTTTGGATCTAAGCCAATTGC
ATTTCTTGCATAATATTTGAAATAGGTGGAAATCGGTGTTCCTGATGGTTATTCAAGCGGCTGTCCTCTGAAGACTTTCAAGTTTTTCAAGACTAAGAAATTTCAAACTGGCTCCTCACA
CATGAAGTTTGGCTTCCAAAACACTAGGACTCCTTGGTG
GTAAGTAGTTTAATTTGTATGCACATGTAAATACTTGTGAAGATATCTATGGAAATAATGTTACAAAGGGACATAGTAGCA
AGATTTGATTGAATGCACGTTCAAAACCTCTTTACACTGACAATTTAAATCAATTAAATCTATATCTTAATTGCCTTTTGATGGTTCAACATATAGCTTTTTGTTGATAGAAGATTTAGT
TCAGCAAACAGGATTATTGGAAGAACATGCTCAGTTAGAGTTTACTATTGTTTTTTGGTATGTGAATTATTAGGGATGGAAGTGTGATATATGGGAACAATGAGAAGGGAATGGGCAGAG
TAAGGACATTCAAAGAGGGAAAGCTGAAGATCTCAGAAGATGGGCTTCTTGAGCATGATGAGAAAGGTATTCCCGTATCCGGCGATGTTCGAAATTCATGGGCTGGTTATTCCCTTCTGC
AGGCTTTGTTTATCAAAGAGCACAATGCAGTATGTGACATGCTAAAA
GTAAGTCAAATTATTTTCATCTGTTGCATAATTTGGCTCCATTTTTTGCCTCGGAAATTAATGTGCAGTTTTA
TGTTCTTTGCTTATAGGAGCACTATCCTGATTTTGATGATGAGCAACTCTATAGGTATGCAAGATTGGTGACTTCAGCAGTCATTGCAAAAATCCATACAATTGATTGGACTGTAGAACT
CTTAAAAACTGATACTCTTTTGGCATCCATGAGGATCAACTG
GTAAGTCTGCATAAGGATATATTTTGCAGAAGATATGCTGTTTTTTTAATTAATACAAATTGTATATGCAGCTAAAGT
AAAACTTGCATTTTCTTTTGGCAGGTATGGATTTTTGGGGAAGAAATTCAAAGATTCATTTGGAAATATTTTGGGACCCGAGCTTAGTGGATTAGTTGGTCTTAAGGAGCCAAGAGATCA
TGGAGTTCCCTATTCGCTTACTGAAGAGTTCACGAGTGTTTATAGGATGCATGCACTCTTGCCTGAGGAGCTTGTCCTTCGAAACATCAAGCCTACAACAGGAGAAGACAAATGCCCTTC
AATACTTGAAAA
GTATACTCTTATCTCTCATTGATTCTAGTTTTGTAACTAAGAGCTAAGAAATTTTATGTTTCTTTTGAGTTGCTTTTAACATGAAAAAGGGTAACGAGTACAATTGCA
TATGTAGGGTGCCAATGACAGAAATGATAGGAAAACAAGGGGAAAAAAGGCTTTCAAAAATAGGAATGGAGCAAATGTTAGTATCCATGGGTCACCAACCATGTGGTGCTATTACTTTAT
GGAACTTTCCAACATGGCTAAGGAACCTCATTGCACATGATATCGACGGAGAAGAAAGACCTGATCCAGTTGACATAGCTACTATGGAAG
GTAGTGTAGTGTAGTGGAGTACATGGTTTT
GTAATAATTTTATATGATCAACTTGTTATAAAATGATGAATATTTTGTTTACTAGTTTATAGAGATAGAGAAAGGGGAGTAGCGAGATATAATGAATTCAGAAGAAACATGCTAATGATC
CCAATTAGTAAGTGGGAAGATTTAACAGATGATGAAGAGGTTAATGAAGCTCTCAAAGAGGTATATGATGATGATGTTGAGAAGCTGGACTTGATAGTTGGTCTACATGCTGAGAAGAAG
ATCAAAGGGTTTGCTATAAGTGAGACTGCTTTCTTTATCTTTGTGATCATGGCTTCAAG
GTAAGTTTTAAGCACTAGATAGATAGTATGAAAATAAAATTTGATTATTTTGGTTTGGAAT
CTTATGTGGTGATTATGATGTTTAGGAGGCTAGAAGCTGATCGTTTCTTCACAACAAATTTCAACTCAAAAACATACACAAACCAAGGTTTTGAATGGGTAAACAAAACAGAGTCTTTGA
AGGATGTGATTGACAGGCACTTCCCTGAGATGACTAAAAATTGGATGACAAGCTCAAGTGCATTCTCTGTGTGGGATTCAATGCCAGATCCTAAGAAATACATTCCTCTATATTTGAGAT
AA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCTTCTCTTTTCTCTACACCCTTCATTCACCCTGGTCTGCAACCTCTTGTGGCCAAAATGACCCTCTTTGATACCATACTTTTCTATGTGATACATTTTGTGGACAAAATTGTG
TTGTGGCATAAGCTTCCAGTGTTGTTGGGGGCAATATACTTGGGAATTAGGAGACACTTACACTTTCGTTACAATCTGTTGCATGTGGGAGGAGTGAGTGGCAACAATTATGATACACAA
CACTATGCATATCGTACTCCGGCAGGCACGTGCAACCACCCTGACGATCACTTGATCGGTAGTCAGGGAACTATCATTGGCCGGAATATGCCTCCGACGACTTTAAATTATGGG
CTGTTA
GACCCTCACCCTGCAGTGGTGACCTCGAAGCTTCTAGCAAGAAAGAGCTTCATAGACACAGGGAAGCAATTCAACATGATAGCTTGTTCATGGATACAGTTCATGATTCATGATTGGATT
GATCATTTGGAGGACACTGAACAG
GTGGAAATCGGTGTTCCTGATGGTTATTCAAGCGGCTGTCCTCTGAAGACTTTCAAGTTTTTCAAGACTAAGAAATTTCAAACTGGCTCCTCACAC
ATGAAGTTTGGCTTCCAAAACACTAGGACTCCTTGGTG
GGATGGAAGTGTGATATATGGGAACAATGAGAAGGGAATGGGCAGAGTAAGGACATTCAAAGAGGGAAAGCTGAAGATCTCA
GAAGATGGGCTTCTTGAGCATGATGAGAAAGGTATTCCCGTATCCGGCGATGTTCGAAATTCATGGGCTGGTTATTCCCTTCTGCAGGCTTTGTTTATCAAAGAGCACAATGCAGTATGT
GACATGCTAAAA
GAGCACTATCCTGATTTTGATGATGAGCAACTCTATAGGTATGCAAGATTGGTGACTTCAGCAGTCATTGCAAAAATCCATACAATTGATTGGACTGTAGAACTCTTA
AAAACTGATACTCTTTTGGCATCCATGAGGATCAACTG
GTATGGATTTTTGGGGAAGAAATTCAAAGATTCATTTGGAAATATTTTGGGACCCGAGCTTAGTGGATTAGTTGGTCTTAAG
GAGCCAAGAGATCATGGAGTTCCCTATTCGCTTACTGAAGAGTTCACGAGTGTTTATAGGATGCATGCACTCTTGCCTGAGGAGCTTGTCCTTCGAAACATCAAGCCTACAACAGGAGAA
GACAAATGCCCTTCAATACTTGAAAA
GGTGCCAATGACAGAAATGATAGGAAAACAAGGGGAAAAAAGGCTTTCAAAAATAGGAATGGAGCAAATGTTAGTATCCATGGGTCACCAACCA
TGTGGTGCTATTACTTTATGGAACTTTCCAACATGGCTAAGGAACCTCATTGCACATGATATCGACGGAGAAGAAAGACCTGATCCAGTTGACATAGCTACTATGGAAG
TTTATAGAGAT
AGAGAAAGGGGAGTAGCGAGATATAATGAATTCAGAAGAAACATGCTAATGATCCCAATTAGTAAGTGGGAAGATTTAACAGATGATGAAGAGGTTAATGAAGCTCTCAAAGAGGTATAT
GATGATGATGTTGAGAAGCTGGACTTGATAGTTGGTCTACATGCTGAGAAGAAGATCAAAGGGTTTGCTATAAGTGAGACTGCTTTCTTTATCTTTGTGATCATGGCTTCAAG
GAGGCTA
GAAGCTGATCGTTTCTTCACAACAAATTTCAACTCAAAAACATACACAAACCAAGGTTTTGAATGGGTAAACAAAACAGAGTCTTTGAAGGATGTGATTGACAGGCACTTCCCTGAGATG
ACTAAAAATTGGATGACAAGCTCAAGTGCATTCTCTGTGTGGGATTCAATGCCAGATCCTAAGAAATACATTCCTCTATATTTGAGATAA

Retrieve as FASTA