Entry information : Mt2CysPrx01 (Medtr1g105090.1 [4.0] / Medtr1g105090[3.5] / Mt2CysPrxA)
Entry ID 5150
Creation 2007-04-08 (Christophe Dunand)
Last sequence changes 2014-07-31 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-20 (Catherine Mathe)
Peroxidase information: Mt2CysPrx01 (Medtr1g105090.1 [4.0] / Medtr1g105090[3.5] / Mt2CysPrxA)
Name (synonym) Mt2CysPrx01 (Medtr1g105090.1 [4.0] / Medtr1g105090[3.5] / Mt2CysPrxA)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Flowers
Leaves
Mixed tissues
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Mt2CysPrx01
start..stop
S start..stop
Pt2CysPrx01 427 2e-153 1..267 1..269
Ps2CysPrx 419 3e-150 1..267 1..263
Pt2CysPrx02 417 8e-150 1..267 1..263
Mt2CysPrx02 416 3e-149 23..267 19..265
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 25005125..25005334 210 N° 2 25006363..25006437 75 N° 3 25006582..25006663 82 N° 4 25006747..25006826 80
N° 5 25007861..25007986 126 N° 6 25008390..25008503 114 N° 7 25008643..25008759 117  
join(25005125..25005334,25006363..25006437,25006582..25006663,25006747..25006826 ,25007861..25007986,25008390..25008503,25008643..25008759)


exon

Literature and cross-references Mt2CysPrx01 (Medtr1g105090.1 [4.0] / Medtr1g105090[3.5] / Mt2CysPrxA)
Literature Cheung,F., Moskal,W., Cooper,J.D., Xiao,Y., May,G.D. and Town,C.D. Construction and analysis of normalized cDNA library from flowers,seeds and stems of Medicago truncatula
DNA ref. GenBank:   AC229736.4 (128601..132231) Phytozome 11:   chr1 (25005125..25008759)
EST ref. GenBank:   DW015306 [5' end]
Cluster/Prediction ref. Phytozome Gene 11:   31099141 UniGene:   Mtr.14443
Omic ref. Gene atlas:   Mtr.12260.1.S1_at Legoo:   Mtr.12260.1.S1_at
Protein sequence: Mt2CysPrx01 (Medtr1g105090.1 [4.0] / Medtr1g105090[3.5] / Mt2CysPrxA)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   267
PWM (Da):   %s   29059.89  
PI (pH):   %s   6.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSATTTSASSLFSSLNPKSSLFSPKLPSSSTLSIPNSLPKPFSLPSLSFTRPSLHHSSRRSSFLVKASSELPLVGNAAPDFEAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFEAINTEILGVSVDSFSHLAWVQTDRKSGGLGDLNYPLVSDVTKSISKSYGVLIPDQGIALRGLFIIDKEGIIQHSTINNLGIGRSVDETKRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKDYFAAV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 6 introns) and 27 ESTs. DW015306 (not included in the unigene). Cultivar="A17".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATGCTCAGCTACTACTACCTCTGCTTCTTCTCTCTTCTCATCTCTAAACCCTAAATCCTCACTTTTCTCTCCCAAATTACCCTCTTCTTCTACTCTCTCTATCCCCAATTCTCTT
CCTAAACCATTCTCTCTCCCTTCACTTTCCTTCACTCGCCCCTCGCTTCATCATTCTTCTCGCCGTAGTAGCTTTCTTGTTAAAGCCTCT
GTAAGCATTCCCCCAATTTTGTTTTTGAAA
TTTTCTGCATTGTTGAAAATGTTACTGTTGTTTATTGCTGTGTGTGTTTTTTCTGTATCTTAATTATGTTAATTAAACATTAATTGATTATTGGGTTTGTTGATAATTAGATATGCTAGT
TGGTTGTGAAATTTGTTTTAATTTGAGTATTTCAGCAACACTGCTTTAGTGCATTTCAGTATTTTTAAGCTTAAAGTATTGAAATTTGTATAATATTTTATTTTTGTTGACAATTACAAT
ATTTCTAGTTCGTGTTGTATTTTTAGGATTTTTACATTTAATCTCTGAATTTTAGCATAAGCTTGGATTGACTTATATGAGCTTATTCACCTGTATTATGCATGTGGATAAGCTCATATA
AGGCCCCCTAAATTGACAGGCTGTATTAGCATTTGTCAGTCTGTTTGGGAGAGCTTATGAAAACAACTTATGACTTTCTATAGTAAGATATTTTAAGCTTGTTTTTATAAGCTCTCCAGG
ATAGCTTATGAAAACAACTTATAGCTTATATGAAAACAAGTTGACTTCATTTTGACCTACAATGCTTTATTGCATTTGGGTATTTTTAAGCATAAAGTATTAGAATGTCTACAATATTTC
TAGTTCATATGCATTTTTCGGTTTTTTGTCTTTAATCACTAAATCTTAGGGTCTGCTTGGATTGACTTATTTGAGCGCTGTTTTCATCTTATTTCCAAATTCAATAAGATCTCCAAGATA
GCTTATGAAAACAACTTATAGCTTATATGAAAACAATTTGACTTTATTTTACCGTCTGTTATAGAAAACAGTTTGACTATACATAAGCAAGTTGTTTATCCAAATTATGGCCTTGCTCTG
AGCTAGAATGTTCAATGCATTTGGGTGTTTTTAAGTTTTAAGCATAAAGTATTGAAAATTTGAAATTTCTTCAATATTTCTAGTTCATGTGCGTTTTTGAGAATTTTTCTTTAAAATGAC
CAAATCTTAGTCTTTAAACTTCTTGTTTGACCTCACAGAGTGAGCTTCCATTGGTTGGAAATGCAGCACCTGATTTTGAAGCAGAGGCTGTTTTTGATCAAGAGTTTATCAACGTACGTG
GCCACCAACCAAAGCAAATAAGAATACTGATTCTTACTAGATTGAATATTTTCTTTGCATTTTTATTATGTGGTTATTTTCGAGTAATTGCTGTTGGAAACTTTCATGTTTGATTGACTA
AATCATTTTCATTCCAGGTCAAACTCTCTGACTACATTGGGAAGAAGTATGTTATCCTCTTTTTCTACCCATTGGACTTCACCTTTGTTTGCCCAACAGGTTGGTTAGTCAGGTCGATCT
AGTCGTGCTTTTAAATTTCTTTCTTTAACTTCCTAATGATAATGTGTGATACTTGACTGCAGAAATCACTGCTTTCAGTGACCGACATGCAGAGTTTGAGGCAATAAATACCGAGATTTT
GGGTGTTTCAGTGGACAGTGTG
GTACGTTGTGTGTCAATGTTTGTCTGCATAATTTCATGTTATACTTCATTATGACATACCTGCTTTCTGTCTATACCGAGATTTTGGGTGTTTCAGTG
GACAGTGGTACATTGGCTTAGACTGTTTCTTTTATCATTACTGTTGACCTAGTTAATGTTGTGTGTCAATGTGTGTGTGTATGCATAAGTTCATGTTATATTTCATTATGACATACCTGC
TTTGTGTCTATTAGTTAGCAAGAAAAATGAATCAACTGCAAAGGATTACAGGGCATTTTAAAGATTCCATACTGTTTAAGGATTTATTTTGTAGAGATAAACTAGTTCTTACTATAAGGT
TAACAGTTCATACATGTCGTATTTTCACGTCTCTGAATAATTGCTGAATTGAATAAGAGTATTGTCAGAGGGAATTACTTCATAAATAAAGGAAAATGAAAAAATGTGAATGAACATTTG
TTCAAACATAAATAATTGAAATATATCTTGTTAATCTACATATGTAATGAGATACATAGCATTTGTATACCAATGCACACAGTCTTTACATAGACTGCAAGGATACGCTCAGGGGCGGAG
CCACCCCCCAGCTAGCCTGGGCTAATGCCCAGGCTCAGCTCCAACTTTCTTTGTAGCAAGCCCTACCATTACTAGAATTTTTAGCTTTTCCTGCGGATTTTTGTGTAAATTCCGCAAGAA
ATGTATTTCCTGCAGATTTTGCCAAGGATTTAGGTTCTGCAGGAAAGATATATCCGTAGGAAATGTGAATTTATCTGCAGGAAATGTGAAATTATTCGTAGGAAGGAAGTAACGTTTTGC
GATAAATTTTTTGCCCAGGCTCTATAAAATTCCTGGCTCCGCCACTGGATACGCTCACATGCTGAGTGCTGACACATACCCTTGAAAAACAAGGCTTGTTGTCTTAGTATCTGATAGGTT
CTTTATGTTCTTATGTATGTGGTATAACCTATGTAACAGAAATTCCAGCATCTGTTTCTTTTTTTTATTAGTGACGCCGTTGTTTCTATCGTGCAGTTCTCGCATCTTGCATGGGTTCAA
ACAGATAGAAAGTCAGGCGGCCTTGGTGACTTGAATTATCCTCTGGTTTCCGATGTCACCAAATCCATATCAAAATCTTACGGTGTTCTCATTCCTGATCAG
GTATGTCCTAACATATTA
AAATAGTGTAACTTATGTATGGCTGGATTGTAGTAAAGCAACAGCCGTCTAGATTTTCTGTTGTATCATCTCTCCCTAAACGAACTTATCAAGGGTATGCCATATCTACGGGGAATGCTC
TCCCATTTGTAGAATTTCCCGAGTTATCGGACTTGCTATCTAATCAAAGCAAGTTTTTATTTGACTTTTTAAGGAATTGAACTAGGACATTGCTTTTCCTTCCCCAACACTTGTCCTTTA
CGCTCATATTTCAATGTTGTTTTGGAATGAAATTTACGATGCTTAATAGCATTAACCAGTCAAAAGTTGGCATCTAAACTATTGTCTTCCATTCCACTATTTTGGACTTGTGTCATAATG
TGCCTAAAAATTCCCAATGTTGCAGGGAATTGCATTGAGAGGATTGTTCATTATTGACAAGGAAGGGATTATTCAGCACTCTACCATCAACAACTTGGGAATTGGTAGAAGTGTTGATGA
GACAAAGAGAACACTACAG
GTGATTATACAACTAATTAGAACCACATCAAGATTGAACAATATCTATTTAGAATATCACATTTTTATTTGTTCGCTTCTATATCCGTTCTATCGTGTACA
TAACTTCATTGTTCCCTTGATGTGCATTTGTTTTGCAGGCCTTGCAGTATGTGCAGGAGAACCCAGATGAAGTTTGCCCTGCTGGATGGAAGCCTGGGGAGAAGTCCATGAAACCAGACC
CAAAACTTAGCAAAGATTACTTTGCTGCGGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATGCTCAGCTACTACTACCTCTGCTTCTTCTCTCTTCTCATCTCTAAACCCTAAATCCTCACTTTTCTCTCCCAAATTACCCTCTTCTTCTACTCTCTCTATCCCCAATTCTCTT
CCTAAACCATTCTCTCTCCCTTCACTTTCCTTCACTCGCCCCTCGCTTCATCATTCTTCTCGCCGTAGTAGCTTTCTTGTTAAAGCCTCT
AGTGAGCTTCCATTGGTTGGAAATGCAGCA
CCTGATTTTGAAGCAGAGGCTGTTTTTGATCAAGAGTTTATCAAC
GTCAAACTCTCTGACTACATTGGGAAGAAGTATGTTATCCTCTTTTTCTACCCATTGGACTTCACCTTTGTTTGC
CCAACAG
AAATCACTGCTTTCAGTGACCGACATGCAGAGTTTGAGGCAATAAATACCGAGATTTTGGGTGTTTCAGTGGACAGTGTGTTCTCGCATCTTGCATGGGTTCAAACAGATAGA
AAGTCAGGCGGCCTTGGTGACTTGAATTATCCTCTGGTTTCCGATGTCACCAAATCCATATCAAAATCTTACGGTGTTCTCATTCCTGATCAG
GGAATTGCATTGAGAGGATTGTTCATT
ATTGACAAGGAAGGGATTATTCAGCACTCTACCATCAACAACTTGGGAATTGGTAGAAGTGTTGATGAGACAAAGAGAACACTACAG
GCCTTGCAGTATGTGCAGGAGAACCCAGATGAA
GTTTGCCCTGCTGGATGGAAGCCTGGGGAGAAGTCCATGAAACCAGACCCAAAACTTAGCAAAGATTACTTTGCTGCGGTGTAA

Retrieve as FASTA