Entry information : Mt2CysPrx02 ( Medtr7g105830.1[4.0] / Mt2CysPrxB)
Entry ID 5151
Creation 2008-10-08 (Christophe Dunand)
Last sequence changes 2016-04-07 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: Mt2CysPrx02 ( Medtr7g105830.1[4.0] / Mt2CysPrxB)
Name (synonym) Mt2CysPrx02 ( Medtr7g105830.1[4.0] / Mt2CysPrxB)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Mt2CysPrx02
start..stop
S start..stop
Ps2CysPrx 461 6e-167 3..265 2..263
Pau2CysPrx01 424 2e-152 3..265 2..261
Mt2CysPrx01 424 3e-152 1..265 1..267
Pv2CysPrx01-2 422 8e-152 3..265 2..260
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42967177..42967380 204 N° 2 42968587..42968661 75 N° 3 42968736..42968817 82 N° 4 42968900..42968979 80
N° 5 42970052..42970177 126 N° 6 42970441..42970554 114 N° 7 42970687..42970803 117  
join(42967177..42967380,42968587..42968661,42968736..42968817,42968900..42968979 ,42970052..42970177,42970441..42970554,42970687..42970803)


exon

Literature and cross-references Mt2CysPrx02 ( Medtr7g105830.1[4.0] / Mt2CysPrxB)
Literature Liu,J., Scott,A.D., Harris,A.R., Gonzales,R.A., Bell,C.J., Flores ,H.R., Inman,J.T., Weller,J.W., May,G.D. and Harrison,M.J. Expressed Sequence Tags from the Samuel Roberts Noble Foundation. Medicago truncatula phosphate-starved leaf library
Protein ref. UniProtKB:   G7ZUV5
DNA ref. Phytozome 11:   chr7 (42967177..42970803)
Cluster/Prediction ref. Phytozome Gene 11:   31082960 UniGene:   Mtr.6479
Omic ref. Gene atlas:   Mtr.25633.1.S1_at Legoo:   Mtr.25633.1.S1_at
Protein sequence: Mt2CysPrx02 ( Medtr7g105830.1[4.0] / Mt2CysPrxB)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   266
PWM (Da):   %s   29017.98  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACCSAPSASLLSSNPNILFSPKLSSPPHLSSLSIPNASNSLPKLRTSLPLSLNRFTSSRRSFVVRASSELPLVGNAAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFAELNTEILGVSVDSFSHLAWVQTDRKSGGLGDLNYPLVSDVTKSISKSYGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETKRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 6 introns) and 42 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTGCTCAGCTCCATCTGCTTCTCTCTTATCTTCAAACCCTAACATCCTCTTCTCTCCCAAATTATCTTCTCCACCACATCTTTCTTCTCTCTCCATCCCCAATGCCTCCAAT
TCTCTCCCTAAACTACGCACTTCTCTCCCCCTTTCCCTCAATCGCTTCACTTCTTCTCGCCGCAGTTTCGTCGTTAGAGCTTCT
GTAAGTTCTTCAACAATCCCTCTTTGTTGAGCTTAT
GTGTTTTGTTGTGGTTGAATTTCTGTTTGCAGCATTGTCCAGCTTATCAATTGATAGTCTATGTTTGGATTTAAGTTTATAAAATTACTTTCGATTATACTTCTTTTTTGCAAAATTAAG
TTTCATTAAAATATGAGTTTGGATAACTTTTTCTCAATTACATGTATCACATAATGTAATTTGTTTAGTGATACTTATCAAAAGTGCTTTTGAATGAGTAATTCGTATGACTTTTTATAA
TGCAGTATAAGGGTCTATTTGGCAAGTCCAAATTTTTAGCTTATAACTTATGTCTTATAAGTCCATTTGATTAAAAATGACCCGTTTGGTAACAATCACTTTCTTATGAGCTTATAACGT
TTTTCGATAAGCTAATTCAAGTAGCTTAAAGCTTATCACTATTTATTCAAATTTTACCCATGTATTCTTAATTGAAAAAAAAAAAAATATATTAACTAAATATATTATCTTTATGTCATT
TCATATTTATAAGCTAGTACAATGGCTAATTTACTATCTTTTACAAATTCAATCGGCTAGCTTATTAACCAAACATTACAAATTCAATCGGCTAGCTTATCTGCTATCACCTATAAGCTA
ACTTATCGGCCATTCACTATCTTTTACCAAATAGAGGCTAAGATGTATAGGGTAAAATGGTAAATAAAAAAGTATTAGAGACATTGCTTTCATGGACACATGCACAACATCAGGTAGCCC
AATGAATCTTTGGATAGACTTTGATACCATCTTAGAATTTTAGGTTGGGCAGAACTTTACCTTACAAAACCGACTTGTAAGCTGAAGATTGCACTCACTTATAAACCCATGTTCAGACCT
TATATCTTCCAATGCGAGTCTCGTAACAAATATGAGCCATTGTTGCATTGCAGTGAATAATTTTTTTTTTGTAATGATTGTAAATTTTGTAATTAGAATTTGAATAGTTAAAAACAAGAT
GCGCAATTAGGCATTCCTGACTCTTCCTCCTTGAGGCTTGTAAGCGTTGAAATGGAATCTCTAAAATATTTCATTCATTTGTGTGCTGGTCTTCATCTCCAATTATTGACTGTTGTAACT
TCATTACTAAAGTTGAGAGCACAAGCTATAGAGCATACTTTTTCTCTTGCTTTAATCTGTGAATTAATTTTTTATTTTTCTGTATTAAAGAGCGAACTACCATTAGTTGGGAATGCAGCA
CCAGATTTTGAAGCCGAGGCTGTTTTTGATCAGGAGTTTATCAAG
GTAAACAGATTGTTGCTTGTGAATTGTTTTATTTCATAATTTATTTATCTTTCACTAAAGCAATGTTTTTTCAGG
TCAAACTATCTGAATATATTGGGAAAAAATATGTTATCCTCTTTTTTTACCCATTGGACTTCACATTTGTTTGTCCCACAG
GTTAGTTGACCCTTTAGTAAACTATAGTTGTAGATGCCA
AATCTTTTCTTTTTTCATCCTAACATCTGTTAACTGTCTACAGAAATCACTGCTTTCAGTGACCGCCATGCAGAATTTGCGGAACTTAATACAGAGATATTGGGTGTTTCAGTTGACAGT
GTG
GTTAGTTCTGACCTTATCTTTTAACTCATATAGATTTTATTGATATGACATTGTTTGGTTCACGCTGCTGATTTTGTCTAGTGGTAAAAGGCATTGCTTGCTGTCATTTTTTTTCGT
GATATGAATTACTTATGCGTGCCCATGCATATTTGCCAATGAAGAAAATGAAGGGTGTTCAAAGACTTGGATCGCTTGCAGTCTCACACATTTTCCACCTGTGCATAGTTCATGTTTTGA
AGTTCTTAGTATAGTAGGCAAATCTGCATGGACTCCTTCAGTGGCGGAGCTACTATTGGGATGGGCTGATGCCATGGCACCGTTAATTTTTTATATACTAATCTAGGAGAATTTCGACAT
GAAATTTGCACCTGGCGCAGTAGTTAAGGCCATTGTGTAGCTTAGAGGTTGAGGGTTCCAGTCAGTCTGAACCCTGTTTTAGAATTTTCGTTGATGTAAATCCTCCCTTTTTTACACTTT
CTTTAGCAAAAATGTTGAATGTCAGTTTTGAAATCAGTTTGTATAGGTTAAAATCACAGCAAAACTAATCACTAGACCAGCAAACTAATTTATATATTCTTTATAGATATGACACTTACA
AATTTCGATCATGCTCCGCAACTGGACTCCTTAGTTTTAATTTTCCTCTGCAACTGGCTACATGTAGTATGGAAAAATAGAATGGTTTGGGGAAATTCCTTCCTAGATAATGGAAAGTCA
GAATATCAGTTGGTGAACTCATTCAAAATTTGTTAATTGCAAATGTGTTTTCGTTGATCTTCTGACCACAAATGCAGTGTGACACAAATTTCCTACTAGCACATGCATGCATTATGTGGT
GATATACTATATCTGTACATTCACAGTTATCTTTTTATATCCAATCCAAAGACATTTAGAGGTTAATGAGTTGGATCCAAATATGGTTTATGATTGAACATTATCGTATAATTTGATCCA
TGTAGCCGACCCCACTTAGTGGGATAAGGCTTTGTTATTGATGTTGTTGTCCAATCCAAATACACTTTTAAAGTCTGCTTCTTCTTGATTAGTGGTGCTATTGTTATTATTGTAGTTCTC
GCACCTTGCATGGGTTCAAACTGACAGAAAGTCCGGTGGTCTCGGCGACTTGAACTATCCTTTGGTTTCTGATGTCACCAAATCCATATCAAAATCTTATGGTGTTCTGATTCCTGATCA
G
GTAAATTTTGACACCACGACTTAAATTGTGGCTATTCATTTTCTTCCTATCAAATTCAACATCTGTTGTACTATGATTTCAATATATTCTCTGGAATGAAATATAGGATGCTTTCTATG
TAATAGCTTTACTATCTTGCATGAAGTAGCTTTGTGACTTGTCTAGGTAGTAGGTTCAAATGCAACGCTATGAGCTGTTGTTTTTTATTCCACTTTTTTTACGGATCTGTGTTACAATGA
TTGCAAATGTTTCTGATGATTTAGGGGATAGCATTGAGAGGATTGTTCATTATTGACAAGGAAGGGGTTATCCAACATTCTACCATCAACAACCTCGGAATTGGTAGAAGTGTTGATGAG
ACAAAGAGAACTCTCCAG
GTAATTATATGTGATTTGCACCATACCAGGATTTACCACTTTTTAGTTATCTGTTTTTTCTCTTCTTCCTTTTACCCTTCTAAGTTCTAGTCTTAAATAATG
TTTGACCCCATACATGCATTGGATTTGCAGGCCTTGCAGTATGTGCAGGAGAACCCTGATGAAGTTTGCCCTGCTGGGTGGAAGCCTGGTGAGAAGTCCATGAAACCAGACCCTAAACTT
AGCAAAGAGTACTTTTCTGCAGTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTGCTCAGCTCCATCTGCTTCTCTCTTATCTTCAAACCCTAACATCCTCTTCTCTCCCAAATTATCTTCTCCACCACATCTTTCTTCTCTCTCCATCCCCAATGCCTCCAAT
TCTCTCCCTAAACTACGCACTTCTCTCCCCCTTTCCCTCAATCGCTTCACTTCTTCTCGCCGCAGTTTCGTCGTTAGAGCTTCT
AGCGAACTACCATTAGTTGGGAATGCAGCACCAGAT
TTTGAAGCCGAGGCTGTTTTTGATCAGGAGTTTATCAAG
GTCAAACTATCTGAATATATTGGGAAAAAATATGTTATCCTCTTTTTTTACCCATTGGACTTCACATTTGTTTGTCCCACA
G
AAATCACTGCTTTCAGTGACCGCCATGCAGAATTTGCGGAACTTAATACAGAGATATTGGGTGTTTCAGTTGACAGTGTGTTCTCGCACCTTGCATGGGTTCAAACTGACAGAAAGTCC
GGTGGTCTCGGCGACTTGAACTATCCTTTGGTTTCTGATGTCACCAAATCCATATCAAAATCTTATGGTGTTCTGATTCCTGATCAG
GGGATAGCATTGAGAGGATTGTTCATTATTGAC
AAGGAAGGGGTTATCCAACATTCTACCATCAACAACCTCGGAATTGGTAGAAGTGTTGATGAGACAAAGAGAACTCTCCAG
GCCTTGCAGTATGTGCAGGAGAACCCTGATGAAGTTTGC
CCTGCTGGGTGGAAGCCTGGTGAGAAGTCCATGAAACCAGACCCTAAACTTAGCAAAGAGTACTTTTCTGCAGTGTAG

Retrieve as FASTA