Entry information : PtDiOx02 (POPTR_0012s04690 / Potri.012G052800)
Entry ID 5159
Creation 2007-04-08 (Christophe Dunand)
Last sequence changes 2010-08-12 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtDiOx02 (POPTR_0012s04690 / Potri.012G052800)
Name (synonym) PtDiOx02 (POPTR_0012s04690 / Potri.012G052800)
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtDiOx02
start..stop
S start..stop
CclDiOx01 1127 0 1..632 1..633
CsDiOx01 1125 0 1..632 1..633
EcamDiOx01 1098 0 1..632 1..632
EgrDiOx01 1090 0 1..632 1..632
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4029146..4029238 93 N° 2 4028765..4029025 261 N° 3 4028182..4028331 150 N° 4 4027917..4028050 134
N° 5 4027570..4027783 214 N° 6 4027005..4027150 146 N° 7 4026540..4026767 228 N° 8 4026021..4026223 203
N° 9 4025665..4025908 244 N° 10 4025355..4025580 226  
complement(join(4025355..4025580,4025665..4025908,4026021..4026223,4026540..4026 767,4027005..4027150,4027570..4027783,4027917..4028050,4028182..4028331,4028765. .4029025,4029146..4029238))


exon

Literature and cross-references PtDiOx02 (POPTR_0012s04690 / Potri.012G052800)
Literature JGI.
DNA ref. Phytozome 12:   scaffold_12 (4029238..4025355)
Omic ref. ePlant:   Potri.012G052800
Protein sequence: PtDiOx02 (POPTR_0012s04690 / Potri.012G052800)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   632
PWM (Da):   %s   72735.81  
PI (pH):   %s   7.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSLSSSSFIHPQLRHIVYKMNLFDTLLFFVIHFVDKLGLWHRLPVLLGLAYMAIRRHLHQRYNLLHVGGINGQKYETEEFSYRTADGKCNHPGDDIIGSQGTFFGRNMRPANSRYGLLDPHPTVVANKLLARNKFIDNGKQFNMIACSWIQFMIHDWIDHMEDTQQVELKAPDKIADGCPLKSFKFYKTKKVSTGSPYMKTGSLNTRTPWWDGSVIYGNNEDGMRKVREFKDGRLRIAGDGLLEHDEKGIPISGDVRNCWAGFSLLQALFVKEHNAVCDMLENYPDFDDEKLYRHARLVTSAVLAKIHTIDWTVELLRTDTLLAGMRINWYGFLGKKIKDLFGHFGGPVLSGLVGLRRPRDHGVPYSLTEEFVSVYRMHSLLPEKLILRDIHSTASEYECPPVVEEVPMREMAGKDGERRLSELGMEQMLVSMGHQACGAVKLWNYPSWMRNLVAHDINGEDRPDQVDMAAMIYRDRERGVARYNEFRRNLLMIPISNWEDLTDDEEVIEALRDVYGNDVEKLDLLIGLHAEKKIKGFAISETAFFIFLLIASRRLEADRFFTTNFNSRTYTEKGLEWVNKTETLKDVIDRHFPGMTKKWMKCTSAFSVWDSEPNQTTYIPLYLRPAP

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns). No EST. Incorrect prediction of intron 8 from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCTCTCTATCCTCTTCCTCCTTCATTCATCCTCAGCTAAGGCATATTGTTTACAAGATGAATCTTTTTGACACTCTGTTGTTCTTTGTTAGTATCCCATTATCTGTTCATCAC
CTTCATTTTCTCTGCTTAATTAATCATATGCCTTGATTACATGTATGTTCTTCCCACTGTTGATGTGTTTGTTTGCATGTCTGAATTTACCAGGTTATTCATTTCGTGGACAAGCTGGGG
TTATGGCACAGATTACCAGTACTTTTGGGACTTGCTTATATGGCAATTAGAAGGCATCTGCACCAACGTTACAATCTCTTGCATGTTGGAGGAATCAATGGTCAGAAATATGAGACTGAA
GAGTTTTCTTATCGAACGGCAGATGGGAAATGCAATCACCCTGGTGATGATATTATTGGAAGCCAAGGAACTTTTTTTGGTCGCAACATGCGCCCAGCAAATTCAAGATATGGG
GTTCGT
GTAGTGATCCAACTGATTATATACTTGGAATTCATTGTTAATTAAGAAAAGAAATCCTTAATCACCCTATAAGCATTCCATTAATACAATTTGTTTTTCAAACTCACCCTTGTATTTCTC
TACGTTCATTTCCAACATATAAAAACTCTAGTTGTTTCAGTGAGTTGAAAGCGAGGCTGGTAAAGATCTACTAAAATCATAGAAAAAATTGCTAAACGATGAATCATTTCAGTTTACCTT
ATGATATATATTTCCCCATTAAAGAGTCTAAAATTAATGTAAACAAAATGAAACCAATGATTATTATATTAATTGCTTTTGGCAATGAAAGTTTTGTAGATTTTGGATACACATATTTTA
CAAGTGATGAAACAGATTTAAGATGATATGGTGCTCTAGCATACATTTAAGATGTTTGTCTTTGCAGTTGCTGGATCCTCATCCAACAGTTGTGGCCAATAAGCTTTTGGCAAGGAATAA
GTTCATAGACAATGGGAAGCAATTCAACATGATAGCCTGCTCATGGATACAATTCATGATTCATGACTGGATTGATCATATGGAGGACACCCAACAG
GTCCACACTGTCAAGATTATTGC
ACCAACTTTTTTTGTTCTTACCAGAATTAAGAAAATATACAAGGATCCTAGATTGGACTCCCCTCATAGAACTTCAACTAGGAAGACTGATGTTTAATATGTTAGCAGGTTGAACTTAAA
GCACCTGATAAGATAGCAGATGGGTGTCCATTGAAGTCATTCAAATTCTACAAGACAAAGAAAGTTTCAACAGGTTCACCATACATGAAGACTGGATCTCTAAACACAAGGACTCCTTGG
TG
GTAAGTCCTTCTCACATTAAATTTGCGTTTATTGGCATGAAGACGAGGAAGTTCAGGATTCTATGAATTGAACATATAGTACTGTCTTTATTTTTCCCTTTTCAAATTTGCCTGCTTC
TTCTAATTTAAGCAGGGATGGAAGTGTAATTTATGGGAATAATGAGGATGGGATGAGAAAAGTTAGGGAATTCAAAGATGGGAGATTAAGGATTGCAGGAGATGGACTTCTTGAGCACGA
TGAGAAAGGGATTCCCATCTCAGGAGACGTCAGGAATTGCTGGGCAGGCTTTTCTTTATTACAAGCCTTATTTGTCAAAGAACATAATGCTGTCTGTGACATGCTTAAA
GCAAGTGCTCA
TTCTTTCTCCATTTTTTCGTTTTTAGTTTTTCCTGTCTACTACCTTTTTGTGACTCAAGTAAAACTGAAATATCTGCACTGTGTTTGAATGCTGAAATGTGGTCTTTAAGCACATTTGTA
AAACCCTTAAGTGCATATTTTGATCCTAGGCAATTATCCTGTCATTTATGCTACAATTGTCTTCTCATACAAAAAATGGAGATGAAAAACAATGTCATCACATAGTTATGGTCCCACTGA
ATTAAGATCACAAAGATTGAAACTTTTTCCATTAACTAGAATGCAACTCTTTTACAAGAAAATCAGGAAATAAAAATTTCACATGAGTATGAACTTTCTGAAAGAGAAATGAGGATGTCA
ATACATTTGTTTTGCTGATGCTCCGGTTTATTTTCCTTCTGTTTTCAGGAAAATTACCCTGATTTTGATGATGAAAAGCTGTATCGACATGCCAGATTGGTTACTTCAGCTGTCCTTGCC
AAAATTCACACCATTGATTGGACTGTAGAACTCCTTAGGACTGATACTCTCCTTGCAGGGATGAGGATCAACTG
GTGAGATGACAATTCTATTGAATAACTATATAAATTTGCTACACTA
TAGAGATTCCTACACCTTGCAGAAATCGGAGTATATATATATATATATTAAGGCAAGCAGTAGTGAACTGTATGCAGTTGTCATTATTCCAGTTGCTTTCTGGCTCCTCGTAATTAATTA
AAGCTAAAACATCTTTGCAGTTGTTTGCATGTCGCATTTATAGTCAAGTTAATGAGTTGTGTTTGGCACAGGTATGGATTTTTGGGGAAGAAAATTAAGGATTTATTTGGGCACTTTGGT
GGTCCAGTACTGAGTGGATTGGTTGGTCTTAGGCGACCAAGAGATCATGGAGTTCCCTATTCACTGACCGAAGAGTTCGTGAGTGTCTACAGAATGCATTCACTACTGCCTGAAAAACTC
ATCCTGAGAGACATCCATTCCACAGCTTCAGAATATGAATGCCCTCCAGTAGTTGAAGA
GTACTTGTCTTTCCCTCTTCTTTCTTCATATGCTAAATTACATCATTAGAAGTTTTAGATA
TTGTTTGGTAGAGAATTTTTGAAAGATCATAGAAGGATACCAAACCAATCTGCTTCTCTACCTTTTGTTTCTCGGTAATATTAACTTTCAGAAAGCATTTAAAAGCTTGGTGCTTGTTCT
GAATTTTGTTGTCAAACATAATTTACAAAAGCAAGCAGTGATAGAAGTAATTATCTTTCAGACACTGGTTCAGTCATGATGTATTAAATTCTTTACGACTAAGACTAACTCTATTTAAAC
TATATGATGAATTAGGGTGCCAATGAGGGAGATGGCTGGAAAAGATGGGGAGAGAAGATTGTCAGAATTAGGAATGGAGCAGATGCTGGTATCGATGGGTCATCAGGCATGTGGAGCTGT
CAAATTGTGGAACTATCCATCATGGATGAGAAACCTTGTTGCTCATGATATTAATGGAGAAGACAGGCCAGATCAAGTTGATATGGCTGCTATGGAAA
GCAAGTCACTTGCACACTCAAA
ACATCTTCATTTTGTTATTTCCTTTCTTCTTCAAGTATTGGATTGACTCCCTCATAATCCAAGTGTTAACATAAAGTTTTTGTTGATTAGTTTATAGAGATAGGGAGAGAGGAGTTGCTC
GTTACAACGAATTCAGAAGGAACTTACTGATGATTCCGATTAGCAACTGGGAAGATTTGACAGATGATGAAGAAGTTATAGAAGCTCTTCGCGATGTGTATGGAAATGATGTCGAAAAAC
TAGATTTGCTGATAGGCTTACATGCAGAAAAGAAAATCAAAGGCTTTGCGATAAGCGAGACTGCTTTCTTCATCTTTTTACTTATTGCCTCGAG
GTATGCTCTACCCCATCTCACATTTC
AAGATAGAATGATCTCCACCTTTCAGTTCTTTCTCTAATTGATATAAGATAATATCAGGAGGCTAGAAGCTGATCGTTTCTTCACCACCAATTTCAACTCTCGAACCTACACAGAGAAAG
GCCTGGAATGGGTTAACAAGACAGAGACCCTTAAAGATGTGATCGATCGCCATTTCCCTGGTATGACAAAGAAATGGATGAAGTGTACGAGTGCATTCTCAGTCTGGGATTCAGAACCTA
ATCAAACAACCTACATTCCCCTGTATCTAAGACCAGCCCCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCTCTCTATCCTCTTCCTCCTTCATTCATCCTCAGCTAAGGCATATTGTTTACAAGATGAATCTTTTTGACACTCTGTTGTTCTTTGTTATTCATTTCGTGGACAAGCTGGGG
TTATGGCACAGATTACCAGTACTTTTGGGACTTGCTTATATGGCAATTAGAAGGCATCTGCACCAACGTTACAATCTCTTGCATGTTGGAGGAATCAATGGTCAGAAATATGAGACTGAA
GAGTTTTCTTATCGAACGGCAGATGGGAAATGCAATCACCCTGGTGATGATATTATTGGAAGCCAAGGAACTTTTTTTGGTCGCAACATGCGCCCAGCAAATTCAAGATATGGG
TTGCTG
GATCCTCATCCAACAGTTGTGGCCAATAAGCTTTTGGCAAGGAATAAGTTCATAGACAATGGGAAGCAATTCAACATGATAGCCTGCTCATGGATACAATTCATGATTCATGACTGGATT
GATCATATGGAGGACACCCAACAG
GTTGAACTTAAAGCACCTGATAAGATAGCAGATGGGTGTCCATTGAAGTCATTCAAATTCTACAAGACAAAGAAAGTTTCAACAGGTTCACCATAC
ATGAAGACTGGATCTCTAAACACAAGGACTCCTTGGTG
GGATGGAAGTGTAATTTATGGGAATAATGAGGATGGGATGAGAAAAGTTAGGGAATTCAAAGATGGGAGATTAAGGATTGCA
GGAGATGGACTTCTTGAGCACGATGAGAAAGGGATTCCCATCTCAGGAGACGTCAGGAATTGCTGGGCAGGCTTTTCTTTATTACAAGCCTTATTTGTCAAAGAACATAATGCTGTCTGT
GACATGCTTAAA
GAAAATTACCCTGATTTTGATGATGAAAAGCTGTATCGACATGCCAGATTGGTTACTTCAGCTGTCCTTGCCAAAATTCACACCATTGATTGGACTGTAGAACTCCTT
AGGACTGATACTCTCCTTGCAGGGATGAGGATCAACTG
GTATGGATTTTTGGGGAAGAAAATTAAGGATTTATTTGGGCACTTTGGTGGTCCAGTACTGAGTGGATTGGTTGGTCTTAGG
CGACCAAGAGATCATGGAGTTCCCTATTCACTGACCGAAGAGTTCGTGAGTGTCTACAGAATGCATTCACTACTGCCTGAAAAACTCATCCTGAGAGACATCCATTCCACAGCTTCAGAA
TATGAATGCCCTCCAGTAGTTGAAGA
GGTGCCAATGAGGGAGATGGCTGGAAAAGATGGGGAGAGAAGATTGTCAGAATTAGGAATGGAGCAGATGCTGGTATCGATGGGTCATCAGGCA
TGTGGAGCTGTCAAATTGTGGAACTATCCATCATGGATGAGAAACCTTGTTGCTCATGATATTAATGGAGAAGACAGGCCAGATCAAGTTGATATGGCTGCTATGGAAA
TTTATAGAGAT
AGGGAGAGAGGAGTTGCTCGTTACAACGAATTCAGAAGGAACTTACTGATGATTCCGATTAGCAACTGGGAAGATTTGACAGATGATGAAGAAGTTATAGAAGCTCTTCGCGATGTGTAT
GGAAATGATGTCGAAAAACTAGATTTGCTGATAGGCTTACATGCAGAAAAGAAAATCAAAGGCTTTGCGATAAGCGAGACTGCTTTCTTCATCTTTTTACTTATTGCCTCGAG
GAGGCTA
GAAGCTGATCGTTTCTTCACCACCAATTTCAACTCTCGAACCTACACAGAGAAAGGCCTGGAATGGGTTAACAAGACAGAGACCCTTAAAGATGTGATCGATCGCCATTTCCCTGGTATG
ACAAAGAAATGGATGAAGTGTACGAGTGCATTCTCAGTCTGGGATTCAGAACCTAATCAAACAACCTACATTCCCCTGTATCTAAGACCAGCCCCATGA

Retrieve as FASTA