Entry information : MtPrxII06 ( MtPrxIIF / Medtr2g022660.1 [4.0])
Entry ID 5161
Creation 2007-04-08 (Christophe Dunand)
Last sequence changes 2016-05-03 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-05-11 (Christophe Dunand)
Peroxidase information: MtPrxII06 ( MtPrxIIF / Medtr2g022660.1 [4.0])
Name (synonym) MtPrxII06 ( MtPrxIIF / Medtr2g022660.1 [4.0])
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII002]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Cell culture
Immature seeds
Leaves
Roots nodules
Seeds
Inducers Colletotrichum inoculation
Germination
Methyl jasmonate treatment
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrxII06
start..stop
S start..stop
PsPrxII06 357 6e-128 1..199 1..199
IbPrxII06 310 2e-109 1..199 1..193
EgrPrxII02 306 9e-108 16..199 8..196
EcamPrxII02 305 2e-107 16..199 8..196
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7861897..7862106 210 N° 2 7862216..7862245 30 N° 3 7863006..7863164 159 N° 4 7864745..7864839 95
N° 5 7865162..7865267 106  
join(7861897..7862106,7862216..7862245,7863006..7863164,7864745..7864839,7865162 ..7865267)


exon

Literature and cross-references MtPrxII06 ( MtPrxIIF / Medtr2g022660.1 [4.0])
Literature Cheung,F., Moskal,W., Cooper,J.D., Xiao,Y., May,G.D. and Town,C.D. Construction and analysis of normalized cDNA library from flowers, seeds and stems of Medicago truncatula
DNA ref. Phytozome 11:   chr2 (7861897..7865267)
Cluster/Prediction ref. Phytozome Gene 11:   31063522 UniGene:   Mtr.4086
Omic ref. Gene atlas:   Mtr.32405.1.S1_s_at   Mtr.40654.1.S1_at
Protein sequence: MtPrxII06 ( MtPrxIIF / Medtr2g022660.1 [4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   200
PWM (Da):   %s   21478.03  
PI (pH):   %s   8.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTFVMNRARSSTTLKSVSSVLHGIRSYAKVATGSDIISAASNVSLQKARNWDEGVSSKFSTTPINDIFKDKKVVIFGLPGAYTGVCSSKHVPPYKDNIEKFKAKGVDSVICVSVNDPYTVNAWAEKLQAKDAIEFYGDFDGSFHKSLELTTDLSGALLGTRSERWSAYVVDGKVKALNVEEAPSDVKVSGAETILGQI

Retrieve as FASTA  
Remarks Complete sequence genomic (chromo 2, 5 exons). Cultivar="A17".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAACCTTTGTAATGAACCGTGCTCGTTCTTCAACAACCTTAAAATCAGTTTCTTCAGTTCTTCATGGGATCAGGTCTTACGCAAAGGTTGCAACTGGGTCTGACATAATCTCTGCC
GCATCCAATGTTTCTCTCCAGAAAGCTCGTAATTGGGATGAAGGTGTTTCTTCCAAATTCTCTACCACTCCTATCAATGACATCTTTAAG
GTTACCCCACTTGATTTTTTCTCATTTCAT
TCCAATTTTCAATACCCTTTTTTCATTTTTGTTTAATTACTAATGGGTTCTATTTTTTTTCTTCAATTTGATGTTGCAGGACAAGAAAGTTGTCATCTTTGGTCTCCCAGTAAGTTAACT
TGACAATTTTCTTATAATTATTATGATTTGATATGTATTTTTATTGTTACTTTGTTTTTTGTTGCGTTTGTTTTGTAAAAGTCTCTACTTTTTTGTTTTTATTTTGTATTGTTGCCCTTG
TGTCCTGTTTGGATTAACAACTTAATTTGTAGCTTATAGCATCAACACTTATTATAAGCTATTTCGATTTTTTGTTTTTATTTTTGTATTGTTGCACTTGCGTCCTGTTTGGATTAACAA
CTTAAGTGTAGCTTATAGGATAAACACTTATTATAAGCTATTTCGATAACAAAAGATGAAATAAGGTCATACTGTTTTCGTGTAAACTACAAGTTGGTTTCATAAGTTATGTTGGAGAAT
TTATGGAAATAAGTTGGTCACAAGTGCTTATGGCATTCGACAAGCTCAAATAAGTCAACCCCTTATCATATAAGCACTTATGTATAGGCTGTGTGTATAACATAAAATAAAATAAAGTCA
CCATTTTCATATAAGCTATAAGTTGGTTTCATAAGCTATCATACAGAGTTTTTGCAAATATGTTGAAAACAGATTGAGGACAATAGACATGTTATAAGTTGTTTTCGTAAGCTCTCTCGA
ACAGTCTCAAAGTGTTTACGTCAGTAGATAATTCAAATAAGTCAATCCAAACAGGGCCTTGTTATAAAGAAATGTGTTTTTTATTTTCTTTTCAGTATAGCATTGTTCTAAAGTAGTATT
TTTTGTTGTATGTTTTGATTATCTCTTAGGGTGCATACACAGGAGTTTGTTCAAGCAAACATGTTCCTCCTTACAAGGATAATATTGAGAAGTTTAAGGCTAAAGGAGTTGATTCTGTTA
TTTGCGTGTCGGTTAATGATCCATATACTGTGAATGCATGGGCTGAGAAGCTTCAAGCCAAAGATGCT
GTAAGCGTTTTCTCTTTTTTCTTTTCTGACTATTGTTAAATGCTTTATTTGC
TGTTTGGTGATTTTTCTATGTTTCCTTTGTGTTTTGTTAGGATATAGAATAATAGCTAACTTGAGTAGTTGAAGTAGTTAAGAATTGTTAGATTAGTTAGTTAGTTAGTTAGTTGACATT
GTTATAGGGCTATTTAAATATTTTATATAATTAAGAGAATACAAGGATATAGATCATTATTGAATATTTGTAAAGTTTAGTGAATAGAGTAGCGACTCTATTGTGAAGGGAAAACATTGG
AGGAGAGATTCTCTCCTATTCTCATTTATCCTTTCTCAATCTTTCAATGGAATTATTTCTCATTTTACTCAATTCTGCCCAGTTTTTGGAATACTTTCTTGTACCAAAAGAAAGATTCCT
TACATGTTTGCATTAGTGATTACCTTTTTACATTTTAGCCTTGTACTAGAAATATGATTGCTGAAGCTACTTGTCCTCATTGTAATACTTATGATGAAACCAGTGTACATGTCCTTTGTG
ATTTTTGGAACCCCCTTGTTGTGGAGGATCAGTGGTTCAAATTCTTCCGCCTTGATCTCTATGATTGACTTCATTGCAATCTAATTTCTGTAAACATTGGAACAGTGGGTCCTAATTGTC
CTACCTTCTTTGGGATTGCCATTTGGTGTCTTTGAAAAGATCATAGGAACACATTTTTGAAAGTAAGGCTATGTTAGTCACCAAATCCTCAGCCAGTTTAACGCCATTATTCACGATACT
TCCAAGCCTATTCCTATTTATTTTGGTCCTAGCATGAGGGAACTTCAAATTTCCTTGAACCCTCCCGATCCTTTCTTGAAGCTTAATGTGGATGGACCTCATAACTCGGCAGGCCTCTCT
TCTTCCAGTGGAGGTCTTAATTAGAGATTCCCCTCTCTCCGAGCATAATGCGCATTTGTGTTTCGTTCAGCAGTTTTTTGTAATTTCCTTCTTTTATCAAAAAAGAACTGTTGCAGTTGT
TTAAATGCATTTCTGTTCTGTTTCTGCTCCTTATTTCTAGCATCACAACTAAAGGATCATTCCAAACTGTAAACTATTTTTAATTGAGTTGGGGATCTTCTTTTGCTGCATTGTCATTTT
GTTAGTGCTATTAGTTTGTAGATTATAATGCAGATACAACAGATTGTTTCTTCTAGTACTATGTATAAAGATAATTAGAAGGCAAGAGATTTGGCTAGAAGAAATATGTGGAAGTTGTAC
TATTTTTTGGTGTGCAAAAAAGAATAAAGAAGTTCTAAAAACACACTCTTAATAAATGTATTCGTTTCAAACTCTCTTTTCCACCACTTTAAGATAGTGCTGGAAAGAGAGTGTCAAATA
GTCATTGCTAGCATTCCTCGAAAGAATAGAGGCGTTTATGAGATCATCACTCTCTAATCCATGAGAAAATTGAGCTTGTCAATGTACATATTATTGAGATCTTAATGTTGATTATCATGC
AGTAATCAATAGCGTGTTGAATTAGGATTTGAAAAAAATAACTATTTGCTGCCTTATGGTATTCGCATTTCCTTTTTTCTTTTTCCAGATTGAGTTTTATGGAGACTTTGATGGGAGCTT
TCACAAAAGCTTGGAATTAACTACTGATCTCTCTGGTGCTCTGCTTGGAACCCGGTCTGAAAG
GTATATTATATACTCCTTGAACCAAGACTGAGCTCATTGACACGAACATTTGTTTTG
ATGATTGAATGAATTTGCTTTCTTCAAATGTTTTAAAACTAGTTCAAATGCCAAAGCGGCGAAGTCACAATTTCACGGTTTAAAATCAATTTAAAAAGAAATAATGTAGTGAAGGAATCA
CTAAACAAGGGTTTATGATAGCATAGCAAAATTGGTGTATATTTAAAAAGGCGCTTAGAAGTTAGAACACAACAATTGTATTATATCTTCAATATAATTAATATAGATTTCAATTCTGAA
AAGAGTAGTTGTTGTTTTAATGTAGATGGTCAGCATATGTGGTAGATGGAAAGGTTAAGGCTCTTAACGTCGAAGAAGCTCCATCTGATGTCAAGGTTTCTGGTGCAGAAACCATTTTGG
GACAAATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAACCTTTGTAATGAACCGTGCTCGTTCTTCAACAACCTTAAAATCAGTTTCTTCAGTTCTTCATGGGATCAGGTCTTACGCAAAGGTTGCAACTGGGTCTGACATAATCTCTGCC
GCATCCAATGTTTCTCTCCAGAAAGCTCGTAATTGGGATGAAGGTGTTTCTTCCAAATTCTCTACCACTCCTATCAATGACATCTTTAAG
GACAAGAAAGTTGTCATCTTTGGTCTCCCA
GGTGCATACACAGGAGTTTGTTCAAGCAAACATGTTCCTCCTTACAAGGATAATATTGAGAAGTTTAAGGCTAAAGGAGTTGATTCTGTTATTTGCGTGTCGGTTAATGATCCATATACT
GTGAATGCATGGGCTGAGAAGCTTCAAGCCAAAGATGCT
ATTGAGTTTTATGGAGACTTTGATGGGAGCTTTCACAAAAGCTTGGAATTAACTACTGATCTCTCTGGTGCTCTGCTTGGA
ACCCGGTCTGAAAG
ATGGTCAGCATATGTGGTAGATGGAAAGGTTAAGGCTCTTAACGTCGAAGAAGCTCCATCTGATGTCAAGGTTTCTGGTGCAGAAACCATTTTGGGACAAATTTGA

Retrieve as FASTA