Entry information : MtPrxII06 ( MtPrxIIF / Medtr2g022660.1 [4.0])
Entry ID 5161
Creation 2007-04-08 (Christophe Dunand)
Last sequence changes 2016-05-03 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-05-11 (Christophe Dunand)
Peroxidase information: MtPrxII06 ( MtPrxIIF / Medtr2g022660.1 [4.0])
Name (synonym) MtPrxII06 ( MtPrxIIF / Medtr2g022660.1 [4.0])
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII002]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Cell culture
Immature seeds
Leaves
Roots nodules
Seeds
Inducers Colletotrichum inoculation
Germination
Methyl jasmonate treatment
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrxII06
start..stop
S start..stop
PsPrxII06 357 6e-128 1..199 1..199
IbPrxII06 310 2e-109 1..199 1..193
EgrPrxII02 306 8e-108 16..199 8..196
EcamPrxII02 305 2e-107 16..199 8..196
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7861897..7862106 210 N° 2 7862216..7862245 30 N° 3 7863006..7863164 159 N° 4 7864745..7864839 95
N° 5 7865162..7865267 106  
join(7861897..7862106,7862216..7862245,7863006..7863164,7864745..7864839,7865162 ..7865267)


exon

Literature and cross-references MtPrxII06 ( MtPrxIIF / Medtr2g022660.1 [4.0])
Literature Cheung,F., Moskal,W., Cooper,J.D., Xiao,Y., May,G.D. and Town,C.D. Construction and analysis of normalized cDNA library from flowers, seeds and stems of Medicago truncatula
DNA ref. Phytozome 11:   chr2 (7861897..7865267)
Cluster/Prediction ref. Phytozome Gene 11:   31063522 UniGene:   Mtr.4086
Omic ref. Gene atlas:   Mtr.32405.1.S1_s_at   Mtr.40654.1.S1_at
Protein sequence: MtPrxII06 ( MtPrxIIF / Medtr2g022660.1 [4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 200
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
21478.03  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
8.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTFVMNRARSSTTLKSVSSVLHGIRSYAKVATGSDIISAASNVSLQKARNWDEGVSSKFSTTPINDIFKDKKVVIFGLPGAYTGVCSSKHVPPYKDNIEKFKAKGVDSVICVSVNDPYTVNAWAEKLQAKDAIEFYGDFDGSFHKSLELTTDLSGALLGTRSERWSAYVVDGKVKALNVEEAPSDVKVSGAETILGQI

Retrieve as FASTA  
Remarks Complete sequence genomic (chromo 2, 5 exons). Cultivar="A17".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAACCTTTGTAATGAACCGTGCTCGTTCTTCAACAACCTTAAAATCAGTTTCTTCAGTTCTTCATGGGATCAGGTCTTACGCAAAGGTTGCAACTGGGTCTGACATAATCTCTGCC
GCATCCAATGTTTCTCTCCAGAAAGCTCGTAATTGGGATGAAGGTGTTTCTTCCAAATTCTCTACCACTCCTATCAATGACATCTTTAAG
GTTACCCCACTTGATTTTTTCTCATTTCAT
TCCAATTTTCAATACCCTTTTTTCATTTTTGTTTAATTACTAATGGGTTCTATTTTTTTTCTTCAATTTGATGTTGCAGGACAAGAAAGTTGTCATCTTTGGTCTCCCAGTAAGTTAACT
TGACAATTTTCTTATAATTATTATGATTTGATATGTATTTTTATTGTTACTTTGTTTTTTGTTGCGTTTGTTTTGTAAAAGTCTCTACTTTTTTGTTTTTATTTTGTATTGTTGCCCTTG
TGTCCTGTTTGGATTAACAACTTAATTTGTAGCTTATAGCATCAACACTTATTATAAGCTATTTCGATTTTTTGTTTTTATTTTTGTATTGTTGCACTTGCGTCCTGTTTGGATTAACAA
CTTAAGTGTAGCTTATAGGATAAACACTTATTATAAGCTATTTCGATAACAAAAGATGAAATAAGGTCATACTGTTTTCGTGTAAACTACAAGTTGGTTTCATAAGTTATGTTGGAGAAT
TTATGGAAATAAGTTGGTCACAAGTGCTTATGGCATTCGACAAGCTCAAATAAGTCAACCCCTTATCATATAAGCACTTATGTATAGGCTGTGTGTATAACATAAAATAAAATAAAGTCA
CCATTTTCATATAAGCTATAAGTTGGTTTCATAAGCTATCATACAGAGTTTTTGCAAATATGTTGAAAACAGATTGAGGACAATAGACATGTTATAAGTTGTTTTCGTAAGCTCTCTCGA
ACAGTCTCAAAGTGTTTACGTCAGTAGATAATTCAAATAAGTCAATCCAAACAGGGCCTTGTTATAAAGAAATGTGTTTTTTATTTTCTTTTCAGTATAGCATTGTTCTAAAGTAGTATT
TTTTGTTGTATGTTTTGATTATCTCTTAGGGTGCATACACAGGAGTTTGTTCAAGCAAACATGTTCCTCCTTACAAGGATAATATTGAGAAGTTTAAGGCTAAAGGAGTTGATTCTGTTA
TTTGCGTGTCGGTTAATGATCCATATACTGTGAATGCATGGGCTGAGAAGCTTCAAGCCAAAGATGCT
GTAAGCGTTTTCTCTTTTTTCTTTTCTGACTATTGTTAAATGCTTTATTTGC
TGTTTGGTGATTTTTCTATGTTTCCTTTGTGTTTTGTTAGGATATAGAATAATAGCTAACTTGAGTAGTTGAAGTAGTTAAGAATTGTTAGATTAGTTAGTTAGTTAGTTAGTTGACATT
GTTATAGGGCTATTTAAATATTTTATATAATTAAGAGAATACAAGGATATAGATCATTATTGAATATTTGTAAAGTTTAGTGAATAGAGTAGCGACTCTATTGTGAAGGGAAAACATTGG
AGGAGAGATTCTCTCCTATTCTCATTTATCCTTTCTCAATCTTTCAATGGAATTATTTCTCATTTTACTCAATTCTGCCCAGTTTTTGGAATACTTTCTTGTACCAAAAGAAAGATTCCT
TACATGTTTGCATTAGTGATTACCTTTTTACATTTTAGCCTTGTACTAGAAATATGATTGCTGAAGCTACTTGTCCTCATTGTAATACTTATGATGAAACCAGTGTACATGTCCTTTGTG
ATTTTTGGAACCCCCTTGTTGTGGAGGATCAGTGGTTCAAATTCTTCCGCCTTGATCTCTATGATTGACTTCATTGCAATCTAATTTCTGTAAACATTGGAACAGTGGGTCCTAATTGTC
CTACCTTCTTTGGGATTGCCATTTGGTGTCTTTGAAAAGATCATAGGAACACATTTTTGAAAGTAAGGCTATGTTAGTCACCAAATCCTCAGCCAGTTTAACGCCATTATTCACGATACT
TCCAAGCCTATTCCTATTTATTTTGGTCCTAGCATGAGGGAACTTCAAATTTCCTTGAACCCTCCCGATCCTTTCTTGAAGCTTAATGTGGATGGACCTCATAACTCGGCAGGCCTCTCT
TCTTCCAGTGGAGGTCTTAATTAGAGATTCCCCTCTCTCCGAGCATAATGCGCATTTGTGTTTCGTTCAGCAGTTTTTTGTAATTTCCTTCTTTTATCAAAAAAGAACTGTTGCAGTTGT
TTAAATGCATTTCTGTTCTGTTTCTGCTCCTTATTTCTAGCATCACAACTAAAGGATCATTCCAAACTGTAAACTATTTTTAATTGAGTTGGGGATCTTCTTTTGCTGCATTGTCATTTT
GTTAGTGCTATTAGTTTGTAGATTATAATGCAGATACAACAGATTGTTTCTTCTAGTACTATGTATAAAGATAATTAGAAGGCAAGAGATTTGGCTAGAAGAAATATGTGGAAGTTGTAC
TATTTTTTGGTGTGCAAAAAAGAATAAAGAAGTTCTAAAAACACACTCTTAATAAATGTATTCGTTTCAAACTCTCTTTTCCACCACTTTAAGATAGTGCTGGAAAGAGAGTGTCAAATA
GTCATTGCTAGCATTCCTCGAAAGAATAGAGGCGTTTATGAGATCATCACTCTCTAATCCATGAGAAAATTGAGCTTGTCAATGTACATATTATTGAGATCTTAATGTTGATTATCATGC
AGTAATCAATAGCGTGTTGAATTAGGATTTGAAAAAAATAACTATTTGCTGCCTTATGGTATTCGCATTTCCTTTTTTCTTTTTCCAGATTGAGTTTTATGGAGACTTTGATGGGAGCTT
TCACAAAAGCTTGGAATTAACTACTGATCTCTCTGGTGCTCTGCTTGGAACCCGGTCTGAAAG
GTATATTATATACTCCTTGAACCAAGACTGAGCTCATTGACACGAACATTTGTTTTG
ATGATTGAATGAATTTGCTTTCTTCAAATGTTTTAAAACTAGTTCAAATGCCAAAGCGGCGAAGTCACAATTTCACGGTTTAAAATCAATTTAAAAAGAAATAATGTAGTGAAGGAATCA
CTAAACAAGGGTTTATGATAGCATAGCAAAATTGGTGTATATTTAAAAAGGCGCTTAGAAGTTAGAACACAACAATTGTATTATATCTTCAATATAATTAATATAGATTTCAATTCTGAA
AAGAGTAGTTGTTGTTTTAATGTAGATGGTCAGCATATGTGGTAGATGGAAAGGTTAAGGCTCTTAACGTCGAAGAAGCTCCATCTGATGTCAAGGTTTCTGGTGCAGAAACCATTTTGG
GACAAATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAACCTTTGTAATGAACCGTGCTCGTTCTTCAACAACCTTAAAATCAGTTTCTTCAGTTCTTCATGGGATCAGGTCTTACGCAAAGGTTGCAACTGGGTCTGACATAATCTCTGCC
GCATCCAATGTTTCTCTCCAGAAAGCTCGTAATTGGGATGAAGGTGTTTCTTCCAAATTCTCTACCACTCCTATCAATGACATCTTTAAG
GACAAGAAAGTTGTCATCTTTGGTCTCCCA
GGTGCATACACAGGAGTTTGTTCAAGCAAACATGTTCCTCCTTACAAGGATAATATTGAGAAGTTTAAGGCTAAAGGAGTTGATTCTGTTATTTGCGTGTCGGTTAATGATCCATATACT
GTGAATGCATGGGCTGAGAAGCTTCAAGCCAAAGATGCT
ATTGAGTTTTATGGAGACTTTGATGGGAGCTTTCACAAAAGCTTGGAATTAACTACTGATCTCTCTGGTGCTCTGCTTGGA
ACCCGGTCTGAAAG
ATGGTCAGCATATGTGGTAGATGGAAAGGTTAAGGCTCTTAACGTCGAAGAAGCTCCATCTGATGTCAAGGTTTCTGGTGCAGAAACCATTTTGGGACAAATTTGA

Retrieve as FASTA