Entry information : VvAPx03 (GSVIVT01024035001)
Entry ID 5171
Creation 2007-04-11 (Christophe Dunand)
Last sequence changes 2011-11-25 (Qiang LI)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: VvAPx03 (GSVIVT01024035001)
Name (synonym) VvAPx03 (GSVIVT01024035001)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Vitaceae Vitis
Organism Vitis vinifera (Grape)    [TaxId: 29760 ]
Cellular localisation Peroxisomal
Tissue types Berries
Flowers
Inflorescences
Leaves
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VvAPx03
start..stop
S start..stop
HaAPx03 508 0 1..289 1..285
CsAPx03 507 0 1..289 1..287
CclAPx03 505 0 1..289 1..287
GhAPx01 504 0 1..289 1..288
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1594161..1594273 113 N° 2 1593904..1594028 125 N° 3 1593171..1593220 50 N° 4 1591949..1592014 66
N° 5 1591815..1591863 49 N° 6 1589712..1589794 83 N° 7 1589545..1589624 80 N° 8 1589299..1589401 103
N° 9 1587828..1588028 201  
complement(join(1587828..1588028,1589299..1589401,1589545..1589624,1589712..1589 794,1591815..1591863,1591949..1592014,1593171..1593220,1593904..1594028,1594161. .1594273))


exon

Literature and cross-references VvAPx03 (GSVIVT01024035001)
Literature REFERENCE 1 Reid,K.E., Liao,N., Peng,F., Schlosser,J., Kirkpatrick,R., Shukin ,R., Barber,S., Holt,R., Siddiqui,A., Jones,S., Marra,M., Bowen,P., Bohlmann,J., Martinez Zapater,J.M. and Lund,S.T. Expressed sequence tags from grapevine (Vitis vinifera cv. Cabernet Sauvignon).
DNA ref. Phytozome 11:   chr3 (1594273..1587828)
Cluster/Prediction ref. UniGene:   Vvi.1497
Protein sequence: VvAPx03 (GSVIVT01024035001)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   289
PWM (Da):   %s   31621.31 Transmb domain:   %s   o260-282i
PI (pH):   %s   7.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALPVVDTDYLKEIDKARRDLRALIASKNCAPIMLRLAWHDAGTYDVHTKTGGPNGSIRTEEEYSHGSNNGLKIAIDFEEVKSKYPKITYADLYLSGVVAVEITGGPTIDFVPGRKDSMISPKEGRLPAAKKGVSHLRDIFYRMGLSGKDIVALSGGHTGRAHPERSGFDGPWTKNPLKFDNSYFVELLQGESEGLLKLPTDKALLDDPEFRGYVELYADEDAFFRDYAVSHKKLSELGFTPSSSSGSKVIAKDSTVLAQSAVGVVVAAAVVILSYFYEVRKRMK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 8 introns, incorrect prediction with FGENESH) and 44 ESTs. Cultivar="Pinot Noir", "Chardonnay", "Cabernet Sauvignon" and "Thompson-seedless".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTACCCGTCGTTGACACAGACTACCTCAAGGAGATCGACAAGGCTCGTCGTGATCTCCGAGCTCTCATCGCCTCCAAGAACTGCGCTCCGATCATGCTCCGCCTGGCGTAATTT
TCTGTTTCTCCCTCACTTTCCCGTGAAAATAAGGCACTTGTGGTTTTTACTTATTTTTTATTTTTTGGATGTTGTTTCGGGAGGGAAACGTGGTTTTGGTTGGTGAATTGTGGTTGTTAT
TGTAGGTGGCATGATGCGGGGACGTACGATGTTCACACCAAGACTGGCGGCCCTAACGGCTCGATCAGGACTGAGGAGGAGTACTCTCATGGTTCGAATAATGGCTTGAAAATAGCTATT
GATTTTTGCG
GTGAGTTTTGTTTTTGGAATTTTGCGAGTGGTGTGTGTTAGTGTTCTGTTTGGCTGCTGAGAAAAATGTGGGAATATGGAAGAAATTCGATGGTTATGGTGAGAATTTTA
TTCAGTTTCTGGCCTATAATTTACTCTGAAGCTATCGCTAATAAGGAAAAAGGCAGGGTTTGATATCTAATCCGGAAGGAACTTGATACGGGCTTGATCAAAACACTTGCCTTATCCCAC
CGCTTTATGGTTTTCTAAATATATCCCTTGTCAAGGATATCAAGAAATTACCAAATTATATAGGCAGCTACCTGGCAGACGGAATTCATTGAATTTTGATTATTTGGCAGTTTGAATCAT
CTTATTTAACTCATATTAGATATTCTGCGGATTGATAAATTATGTGCTAATTACTTTCTCGTGAAATTTTTTTGAAGAGTCAATAGAAGGTCCTATGGTTGCTGCTTGTTCAGTCTGTTC
TATTATTTATCAAATAATTGTTACTAGCTATTTCATGTTTGGATTCTAATCTTTGTTGAGATTTTTGGTTGTTTTGAATTTGTGAGCTTCTGAAGAATCCAATTATGCCATTTTGTGTCT
GTTTGGATTCTTGCCCATATTTCTTTCTTATGAAGTGGATTGATGTTAGGTTTTGTGATTATTTTAAATGGGCATTTTCCTTTCTGATTTCAGAGGAAGTGAAGTCCAAATACCCAAAGA
TCACTTATGCAGACCTATACCAG
GTGATTATAGTGTGGAATGAATTTATTTTCTTGTTTATTGAAATTCAATTGGTTCATTTTGGAACCAAATGGATTGATAGGCATTTTATTTGGCATG
GCTATTAAAGAGTTGAGAGATCACAATGGAATTTGAAAAAAGAATTTGTTGTACTGGTGGATTGCATCGTTCATGCAAACTGAGCCTTTTATATTTGCATCTCTCTCTATGTTTATAACT
TCCAACCTGAATGTGTAAGAAATAGAAACTTTGTTTGGTAGACAGGGAACTGGATCTGAGAAATGATTCCAAAGTTCTTTTACAAGTGTGTGGCAGATAATTGACCTTTTTTTGGAATCG
ATGTTTAATCCTCCCAACAAGGAAGATGAATGATCTTATTTCCTTATTATCTGTGGTCAGCTGCTTTTTGGAATATTTTGTAGGCAACATCCTCCTGCTTTTTCATTGGTGCTCAGTGGG
TTATATCCTCTTATTCATCTCATGCTTTAATGATTGCTATGAAGAGATGAGACCAGTGGAGAATCCTGGAACCATTTTCTGCTTAGGAATTTCCAAATTACTAAATAGTTTGAATGTAGC
ATGGGTCTTGAAGTCAGAAATAAGAATAGATGATCATGCTACACATGGCAGGTGTCTTAACATATGTATATTGTTCTATGGAATGAAACATCTTAAGAGTTTCTCATATATTTCTTTATA
CAGATTTAGTAATTTCTATATGAATAGAAATCATTCAAACAGTTTGTAAACAAACAAACGGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGGCCAACCAAAAAGTTGATGGA
TAGAAATTTAGTAAAGGATAAGTGTTATAATTGAGAGAAAAAGGGAAGAAAAAGGGCAAGCTTATGAAGAGTGTCCAAACAAGCATATTTGTGTGCATTGATTAATAGAACAGATTACCT
TTGTCAATGTCATGCATGTTGTGTTCATGAACACTCTCAAATGCAAATCATGGATTGACATTATCTTCACTATCCTTCGATGTGGAGATTTACTGTCACAATGCCCATCTATCTTACATG
AGTAATGAACACCAATCTAGTAGCATGCTCTATCCATGTTTCTTGTAAATATGAAGAGTGAACTTATTCATAATTAACCAATTGTCTTTTTTTTTTTAGCTTTCAGGAGTTGTTGCAGTT
GAGATCACAGGAGGCCCCACCATTGACTTTGTACCTGGTAGAAAG
GTATGTTAATGTGGCATCTTGATAACATAGCTTGTTATCACTTACCAAATAATCGCTCTTGTAACCGTTTATGTC
TTTGTTTCAGGATTCAATGATTTCTCCCAAGGAAGGGCGGCTTCCAGCTGCCAAAAAAGGTTTTCTAATATCATTCCAAAATGGCCTATAATTGTCGTTAATCAGAGCTTCTTTATGAAC
AAAAAGTTTTTGAGTGTATAGTTTGGTTTATATTATGTGTTATGCTTCATAAATGACTCGTGATTGGACCATAGGCATATAAAAGTTTTGAAATTCTCTGTTCACATGGATGATCAGCTT
TCTGTGACCACATTATGGCCTAACTTTACCATTCTATAGAGCTGTTTTGGTTCTACATAATTGAGGAAAAAGTAAAGAATTGCGTTGAACAACCATTCCAATAGAAAATGGTTGGGTATA
ATACCCCATTAATGAATTAGTGTCTGTTGCTCTTGGTTCTTTTTTCATTATAAGTCTGTATTAATAATATATGGAATCATATTATGTTCAAAATACATGTGGTGCTGGTCAAAGAAGTCG
AGCAAAGTAGGAAGATAATGAGAAGTTACCATTGCTAACATTACATTTTGAATGTATAACAAGTAACATGTTTTAAGGGAATGATTCATGTTATTCCCTAAGACTTTGCATTTGTGGGAT
TGCATATTTCTCTTAAAGGTCTCTTCAATTCAGAACTTGAGTATTTATCGCTCATATATCTGAACCATGGAAATACATTTTAGTCATTATGCTTCAATCATAAAAGTTTAGCAATATTAT
TCATGGGCAGTGCTGATCTAATGTTTGTAAAGCATGTCTCAGGAAGATGCTTATAAAATTTAGCATGCCTTCTGTGGACATTCAGTATTTCCTTGGTAAACTTGCAAACCTTTTTCAGCT
AACATATCAGAAAGATGCTAGTAAATGTGCATGCCCTTGTTTGAACTTTCCACTATTTATTTTAGAGAACCTGCAAACATCCTTGAGTGGGTGAATCTTAGACAAGATAAGTAGCAGTTG
TTCTCTTCTGGGATTAAGTATTTTGTTAGGATGCGTGGTGGGCATGCATTTGCTTGCTGCTGGAAACTAGTTTTTGCTTTCTGAAGCTCTATATCCCACCTAAATCTGGCAGTTGGTCAA
TGAGATAAGAAAACTTTTGACCCATGACTATGCTTGAAGGCACAGATCGCACACCCTCAAATGATGGGGCTGTATGTCCTTTGTATTTGGGGGGGGGGGGGAACATAAAAATGTAGGGCA
CAAAAGTTTTTGGTGCCTAGTTATAGGGTATGTATTATTATGATTTCTTTGCTTTAGGGTACTCAAGCTCCCTTTGTCATATGGATTGTTGAAACTTTTTTTGTGTGAAGATATGAAGAC
TTGTCAAAGCATGGCATGAGAGGATCTTAAGGTGCATGATGTGAGGTTCAATTTTCAGGGATCCAGGGATTTGTGTTTCACTAAGTATTGGATAAAGAGATACATGGGGTCCATGAAAAT
GCTTATAAANNNNNNNNNNNNNNNNNNNNTTAATTATGACAGGTTACATCTTTTATATTCACATGATAATACGATAGAACAAACTCTCTTTGCATGGGTTCGCATAAGCTTTCCTTTGTA
AACTAACACCTTCAGAGAATCTTTGGATGTTAAAGATCTTGACTTGGATAGTAAGTTAGTGACCTTTTCCTTGTTTCCATTAAGTCCTGGTCATGTGCTCTTCATCTAAACCAGTTCAGT
AATTAGTATGTGTAGAATTTGGAGGGTTTTTTTTTTTTTAAGATGAATATTTTTGTGTAAGATTCAGCTGTGTACCATAACAAGCATTGAGGTTTCTTGGATCCGTGATTTATCATGTCT
GCTGGTGGAACTTTAAATTTTACACGAAATGTAATGATTGGGAGAGAAAGTGGAATCATAAGCACTTTAGCTTTTTCAACAGCTATTTCATGTCACTATCATGTAAACTTGCAAACTATC
CAAATATAGCTTCCATTAATGTTCTGTTCTTTTTTAATGACTCCTTTCTCATCATCATGATGCCTTAGGAGAAGTGTACTTTTGCATGCATTGATGCAGTTTGACTAGGTTATATATGAA
TATGTTCAAATTCATATTCTCTTCCAAATGTTGATGTAGGGGTATCACATCTTAGGGACATTTTTTACCGGATGGGCCTGTCTGGCAAGGATATTGTGGCATTGTCAGGAGGGCACACAT
TG
GTAGTTCTCCCTTCAGATTTACAATCATACGTCTTTTTCGGCAATATGTACACACATTTATATAGTTTGGTTGGTTTGATGCTACAGGGAAGGGCACATCCAGAGCGATCGGGTTTTG
ATGGCCCTTGGACTAAGAATCCTCTGAAGTTTGATAACTCATACTTTGT
GTACGACATAAATGAGGGATTGACTTGATTGACTAATTTCTTTATGAACCTATATTATCTCATTTATATAT
TTAACAACATTATAAAAATCTGTTAAGTTCTAACCATCCATTAAATGATAATCATTATTATTATCTAAACAGGGAGTTACTGCAAGGGGAATCAGAGGGGCTGTTGAAACTTCCAACAGA
CAAGGCTTTATTGGATGATCCTGAGTTCCGTGGTTATGTTGAGCTGTATGCAAAG
GTAATATTGGCTTGTTTCAATTTGTCCAATTATGTTCTTAACCATTTTGTATTTTATGATGCCCT
TCAGAACTAACATATAGACAGATGGCAGCAACCTTTATCATGAGTTTTTTCTTTTCCTTACTTCTCAAAAGCAGAAAGCACCACCACCTGATTACTATAACATATTTAGTGTTGGTTTGG
AGTTTAAACTTCACCAAATTGTTCTGCATAGCATCATAGCATTTAGTATTGCCTTTGCTGTTACAACTGAATTTGGCCCAACTGTGCCCTAGTAGGGATAGCAAAGCCAGCCATGATCCA
AACCTCAATTCAGTAAAGCAAGTAGATTTTGAGTTGATCAATTCATCAAACATGCCATTTTCTGAACTGAATTTAACCTGATTGTAAACAGTCTAGTTTTGGTCAGGATAGCTTGATTTA
GCATTTATATTTCATTGTTCTAAGGATATTTTCAAAATTAATTTGGGCCTATAGGTTTGCTCTGGATTGGGCCCCTAATAATTGATTGGTTCCAGCATCACTTTTTCTACCTGAATTTAA
TCCTATCCCACTATGGCCCAAACGTGACTTATTGCTGGCTATTATGCAACAATGCATACCTTTAGATGAATATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTGATCAATAAAAAATTT
AAGATTTGAAACATTTAAAAGAAGCATTCAATAAAAAAGTATCGAATTTATATAAATTTCAGTATATAATTAGAAATTTTAATAATAATAAGAAAGAGTAAAGCTGATAAGGTACGCTTT
TTCAATAAGATGCATATCTTGGCAAGCAAGGCGCTATAACTAGGGAGTAGTGGTGCCTTGAGCTTAGGTGCGCTTAAAGTTCGCCTTTTAAAACTATGGTGAATATGAATGTCAAAACCT
TTTTAAGGCGCTATAACCATTGAATGGCTGTTTTTCTGTTTGCTATGATTTTTGGACTAGAGCCATTTGTAGGATACTCTCAATCAGTTAAGATTGATGCATTTCTGGATCAATTCAACT
TAGTCCAGTTGGCTTTTGTCCTCAGATAGGCTGTTCTCACCATTTTATTCCATTTGCCCTCCTTGGACATTCATAGTAGCTATAATTATTTGCTTAGTTCATTCCCAACTCTTCGCTTCT
CGCAGGATGAGGATGCATTCTTTAGGGACTATGCAGTATCTCATAAGAAACTCTCAGAGCTGGGGTTTACTCCTTCAAGTTCCTCCGGCTCCAAGGTCATTGCCAAAGACAGCACCGTAT
TGGCACAGAGCGCTGTAGGAGTTGTAGTTGCTGCTGCAGTGGTGATCCTGAGTTACTTCTACGAGGTTCGCAAAAGAATGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTACCCGTCGTTGACACAGACTACCTCAAGGAGATCGACAAGGCTCGTCGTGATCTCCGAGCTCTCATCGCCTCCAAGAACTGCGCTCCGATCATGCTCCGCCTGGCGTGGCAT
GATGCGGGGACGTACGATGTTCACACCAAGACTGGCGGCCCTAACGGCTCGATCAGGACTGAGGAGGAGTACTCTCATGGTTCGAATAATGGCTTGAAAATAGCTATTGATTTTTGCG
AG
GAAGTGAAGTCCAAATACCCAAAGATCACTTATGCAGACCTATACCAG
CTTTCAGGAGTTGTTGCAGTTGAGATCACAGGAGGCCCCACCATTGACTTTGTACCTGGTAGAAAGGATTCA
ATGATTTCTCCCAAGGAAGGGCGGCTTCCAGCTGCCAAAAAAG
GGGTATCACATCTTAGGGACATTTTTTACCGGATGGGCCTGTCTGGCAAGGATATTGTGGCATTGTCAGGAGGGCAC
ACATTG
GGAAGGGCACATCCAGAGCGATCGGGTTTTGATGGCCCTTGGACTAAGAATCCTCTGAAGTTTGATAACTCATACTTTGTGGAGTTACTGCAAGGGGAATCAGAGGGGCTGTTG
AAACTTCCAACAGACAAGGCTTTATTGGATGATCCTGAGTTCCGTGGTTATGTTGAGCTGTATGCAAAG
GATGAGGATGCATTCTTTAGGGACTATGCAGTATCTCATAAGAAACTCTCA
GAGCTGGGGTTTACTCCTTCAAGTTCCTCCGGCTCCAAGGTCATTGCCAAAGACAGCACCGTATTGGCACAGAGCGCTGTAGGAGTTGTAGTTGCTGCTGCAGTGGTGATCCTGAGTTAC
TTCTACGAGGTTCGCAAAAGAATGAAGTAA

Retrieve as FASTA