Entry information : VvAPx06 (GSVIVT01008846001)
Entry ID 5172
Creation 2009-02-27 (Christophe Dunand)
Last sequence changes 2012-01-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: VvAPx06 (GSVIVT01008846001)
Name (synonym) VvAPx06 (GSVIVT01008846001)
Class Ascorbate peroxidase    [Orthogroup: APx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Vitaceae Vitis
Organism Vitis vinifera (Grape)    [TaxId: 29760 ]
Cellular localisation Thylakoid-bound
Tissue types Berries
Buds
Cell culture
Inflorescences
Leaves
Pedicel
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VvAPx06
start..stop
S start..stop
GmAPx07 695 0 1..424 20..432
StAPx06 679 0 1..424 1..423
CclAPx02 677 0 40..424 27..395
EguAPx08 679 0 1..424 26..446
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2761329..2761493 165 N° 2 2761583..2761741 159 N° 3 2767075..2767195 121 N° 4 2767265..2767365 101
N° 5 2767458..2767545 88 N° 6 2768405..2768472 68 N° 7 2768561..2768647 87 N° 8 2769814..2769888 75
N° 9 2770003..2770080 78 N° 10 2770182..2770286 105 N° 11 2771673..2771747 75 N° 12 2772038..2772190 153
join(2761329..2761493,2761583..2761741,2767075..2767195,2767265..2767365,2767458 ..2767545,2768405..2768472,2768561..2768647,2769814..2769888,2770003..2770080,27 70182..2770286,2771673..2771747,2772038..2772190)


exon

Literature and cross-references VvAPx06 (GSVIVT01008846001)
Literature REFERENCE 1 Reid,K.E., Liao,N., Peng,F., Schlosser,J., Kirkpatrick,R., Shukin ,R., Barber,S., Holt,R., Siddiqui,A., Jones,S., Marra,M., Bowen,P., Bohlmann,J., Martinez Zapater,J.M. and Lund,S.T. Expressed sequence tags from grapevine (Vitis vinifera cv. Cabernet Sauvignon)
REFERENCE 2 Velasco,R., et al.,. The first genome sequence of an elite grapevine cultivar (Pinot noir Vitis vinifera L.): coping with a highly heterozygous genome.
DNA ref. Phytozome 11:   chr18 (2761329..2772190)
Cluster/Prediction ref. UniGene:   Vvi.8798
Protein sequence: VvAPx06 (GSVIVT01008846001)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   424
PWM (Da):   %s   45490.4 Transmb domain:   %s   o404-423i
PI (pH):   %s   8.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLSGAAAASSRLLPRARLGFSTSSSTPSPSSLSLSSLKGLRSSPLLSHLLHRQXXQKTTSVRASSGGLGFSSVAAPKCSASDPDQLKSAREDIKELLKSKFCHPLLVRLGWHDAGTYNKNIEEWPLRGGANGSLRFEIELKHGANAGLVNAVKLLQPIKDKYSGVTYADLFQLASATAVEAGGPKIPMKYGRVDASGPEQCPEEGRLPDAGPPSPADHLRDVFYRMGLNDEIVALSGAHTLGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKEKIDEELLVLPTDAILFEDPSFKVYAEKYAVDQEAFFKDYAEAHAKLSNLGAKFDPPEGIVIDDGPAEAAPEKFVAAKYSSGKKELSEAMKQKIRAEYEAVGGSPDKPLQSNYFLNIMIVIAVLAFLTTLFGN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 18, 11 introns, incorrect prediction with FGENESH) and 63 ESTs. Cultivar="Pinot Noir", "Chardonnay", "Cabernet Sauvignon", "PN40024" and "Thompson-seedless".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCTGAGTGGCGCCGCCGCGGCCTCCTCCCGCCTCCTCCCCAGAGCGCGGCTCGGTTTTTCAACTTCGTCTTCAACTCCTTCTCCTTCTTCACTCTCCCTTTCCTCTCTCAAA
GGCCTCCGATCCTCTCCTCTGCTCTCTCACCTCCTCCACCGTCAG
GTTCTCTTTCTCTCTATTTTCGTGTCTATATTTTTATGCGATTGTATTGATTCTGAACCTCANNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNGCAGAAAACGACTTCGGTCCGTGCATCCAGCGGTGGCTTGGGTTTCAGCTCCGTGGCGGCTCCGAAATGCTCGGCATCCGATCCGGATCAGCTGAAGAGTG
CTAGAGAAGACATCAAGGAGCTTCTCAAATCTAAATTTTGTCATCCTCTTTTG
GTAATGCGCTCAATTTTAATTTCTTGTTTGGAATTTTTTTTTTTTTTTGGGTGATGCAGCTTTCTGA
TTCAATGAAATCTATTGTTGAATTTCTAGATGATTTCGCTTTAAACTAAATTATTGCATAATCTCCTCTTTCTTTTGCTACCATTTCTCGACATGAATGTCCATCCAACACTGGCTGTGA
AACAATATCTTTAGAATCCGCTGCCTCTGAAACCATTATTCCTGTATAGCTGGTCCTCACCCATAGTATTTTCTGGTTTTGCTTTTAAGAGTTATGCTATTCTCTCCTAAGTCTTAACCA
ATGTTTGGAATTGTGAGACATATAAATGCCTTTTATTTTGGAAGAAAAAAAATTGATCGTATTTTTTCGAAGAAGCAACTTGGGCAGTTGGTTACCATTGCATTACTTTTAAATCATGTT
TGGTTTACAATCCAAATATTCAATCCATGTTTGTTGGTTGGTGGAGATGAGATAAATTATCTCATCACATGTTCATTCAGATGTGATAACTTATCAAACTTTTTTTATTGAAAAATTATC
TAAAAGGGTGTTTTGTGCAAAACGAGGAAATAAAGGGTTATCTAGTTATTAAATTCCTTTGGAGGACCCAACTTATGAGAAGGCAATTTTACATGATTCACCTCTTGTCAATTACTCCAT
ACAAATATGAGAAAAAAAGCAATGAGATTGCTTAAATGAAGTCGAAAAAACCCGGGGAAGAGAGAATATAGGAAAAAATAAATAAATAAAATTAAAATTAAGAAAAAATTTCATNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTATATATATATATGTATTCTTATTTTATTATAAAAAACTAAGTTTTTTTACTTTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAAGTTTTTTGAAATACATTTTCTTTAGTTGTTTATTTTATTTGATTTCTTTTTATAAAAAAGCAGTAGAAGAGGAAAGTTAATTTCCA
ATATTTGATATGAAAACCAAACCCCAAAGTCATTGTGCCATTTTGTACACGTTGCAACAAACTTTGCATTTGCTCGTGAGTAACCAATTCATAACCTTGTTATCTCAAANNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGCTTAGNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTATTTGATAAACAAACAAAAAATAATAT
CACAAACAAAAAGAGAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACTAGTGTATTTTGGGGTTTTAGTTGAAGGATATTTTCAGGATTTTTGCCTTTGGAGGACCCTTTTTTTTTT
TTTTTCATTTTTTCTATCCTCCAAAGGATTGAAACAAACTAAGCAACCCTTTAAGATCCTTATCATTCTCAACCTACCTTTTTAGATAATTTTTNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGTACAACCTAAAATATGTAGTATCATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAAGAAATAAAAAATTACTTATTGGTGCATATTTCGATACATTTCCTCTTTTTT
TTTCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAATTCTTTAACAAAAGTTTGGGAGATACCTTATATATTTGAAAACACTTTCAAAAATTTTAAAACTT
AAGAACATAAAAAATTTTCACTTCCTCAATTTTTTAAAATTTGAAAAGAGTTTTTAAGAATACAAGGTAAATTTTTTACTTTTTTGAATTGGACTTTTTATTTTTAAAGAAAAAATAGTG
TGCCCAAACACTAGCTAAATTATTAATTATAGAATGATTTTCAAATAATACTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNTAGTGATTAGTGTAATAGAAGGATTGGGAATATATGAGACTAGCTATTACTTTTAATTTGTATGTTGGGAAGCTTTTGACATTGTTTAGTAGAAAAAAAAGTTTA
TAAATAATATAGTTATATTTATCTGTTTAAATCATTTTATATTAAATTTGGATGACGAGTCTTAATTCTTTTCTCATGTTGACATGTCAAAAATAAAAGCAAAACTAAAGGAAGATGGAG
GACCAGCACACTAGAGAAGAGGTTATAAAATCAACAGATCTAGAAAACTAGTGTTAATTTTTTTCATCTCACATTGATACTTACTCATGTTATCATGTGTAATCTTACAAATCTTCAGTT
TTTGTTAGTCTCCCATCAGGTATTCCCTATCTGAGCTTTATGTTGTTGTGCTTGTTGGATGGCATAGGTCTATGATTTTTTAAGTAGTTTGACATAATGTTAACTAGGCATCAAGCAAAT
AGTCTTTTTAAAAAGGATCTTTGGATGTGTCTGGTTTGCTTGTTTAGATGCAAAGACAAAGAGAGATATAAGCATAAAGGCTTTCTCGTTGGTACAAAGATAAGTATATTAGAAACAATA
TTAATTTAGGAAGCAATCAATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNGATAGGGATTAAAAAAATCTGATAAAGACATGCAGATGCGCTTCTCTTGAGAGAAATTATGCCTCTTCTAAACAAAGTTGATTGACTCTCTT
CCCCAATATACAACAATCTTTAAACTCAAATTGTTGCAGAAATTTGACTCCACGAACCAAATTTCACCTGTTGCTCACCAAAATCAATTAAAACAATAGAACATATCATAGTAGAGTTTT
TATATTACCAAATATCTAATATAAAAAGCTTGGTTTGATACATCAAAATCCCTAATTCTCTTAAAAAATCTCCCCCACCTAGAACATTTACAAAAGGTAAAATAAAATTAACAAAATAAT
AAAATTATGTGATTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTAAAAAATAACATAAATATAATAACTATAGATTTTAATTTAGCTGTAACATAATGTTAAC
TAGGCATCAAGGAGATGGTCTTTTTAAAAAAACGACCTTTGGATATGTTTATTTAGATGCTAAGACAAAGTAGAAAGATGAGTAAAAATGGTTTCTCTTGAAACAGGTTCGCCTAGGATG
GCATGACGCAGGTACTTATAACAAGAACATTGAGGAGTGGCCTCTAAGAGGTGGAGCAAATGGAAGTCTGAGATTTGAAATTGAGCTGAAACATGGGGCCAATGCAG
GTAATGGTTTGAC
ATTGTTTATAATTTAGTTTGGTTGACAGACATTGTCCTCACAATCTGGCATCTCAGGTCTTGTTAATGCAGTGAAACTTCTTCAGCCTATCAAAGACAAGTATTCTGGTGTGACATATGC
AGACTTATTCCAATTGGCCAGTGCTACTGCCGTGGAG
GTCTTGCTTAATCTTCCATTGGAGTCAATGTTAATTGAAATTGCTGAGCTATTAAAAAAAATATATATTGACCAAATCCTTCA
AAATTTCAGGAGGCTGGCGGACCCAAAATCCCCATGAAGTATGGAAGGGTGGATGCTTCAGGACCTGAACAGTGCCCAGAAGAAGGGAGGCTTCCTGGTAAGATAACTGTGACTAAGTGG
AGCATGTACAAATTCAATAGTGTATTTGTTAAAGCTTGATGCCTCTCTGATATATATGTGGAGTTCAAAAGGATCAGGGTGGAAATAAATGCGACATAANNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTTTGGCTTGTCAATAAAAAAAAGTGGACAACAATGAGAGGAGCTTTGATCAGTTTTGATAAATAGCCATAATTGGACTAGTTT
TTGTATAGGTTTCCTTATATAGTGGAGGAGCTTAAGTCACATTTCTGATCAGATTCTTATATTTTGTTGGGAGGATCCATCCTCCTTCTCTTGCTCTTTTTACCAAGTATTGATATTTCA
TACCTACAGGCATGGGATCTTACCTTGTTCAACCTATTTTGGGAAGATTTAATCAGTATAGTATTCTGTCAACAAATTCTATTTGAGCTTTAATTTTTCTTTTCTGTTGCAAATTAGCTT
GCTTGAAGTGTATTGTTGAATCATAAATTTAGGTGAACTTCTGTTTTTTTGTATTTATGATTTAATTCATTGTCATCTGTACCAACTAACTTTTGAAGTATTGATTTGATGTTTAGATGC
TGGCCCCCCTTCACCTGCTGATCATCTACGTGATGTTTTCTACAGAATGGGGCTAAATGACAAG
GTTATATTCATCAAGTTCACATTACTTTATTCTTAAGTGTTATCTCTATTGATATA
TGATGTTTACTGTTGAACTTTTTGATCTTTAGGAAATAGTTGCATTATCGGGTGCACACACGCTAGGAAGGTCCAGACCGGAACGCAGTGGTTGGGGAAAGCCGGAGACTAAGTATACGG
TATTTGTCAGCATTTTTATTAAATGATGCTAAGTAATGCAGTTTTAAGGGCAACTCAAGTTTGGAATTCCTCAACTGTATTCTCATTTGAGGTTTTTCTACTGAAGTGTTAGTATGAAAA
ATCTGCTAATTAGCCATCATAGAAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTCTTCCCTTATCTACCCTGAAAAGGAGATTTGCTAATCATTTAGG
GGAAGAGCCGTTGGCTTAGGATCATTTCTATGTGGCTAACCATTGATAGAGTTAATCCACTATAATCTAGTGTGGAAATAGCTTTGCTTAATTACATGCAGTTTAGGTAACTGAACTAGT
GGTTTTCAGTGACCATCCACTGATATTAGTTGTATGCTCTTATCATCAATGATCCAGGATATTTAGTAATGCAGGGTTGCTATGCTATGCTCTGCACATTTTATACTATCCCACTTGGGC
ATCACAATTCACTACTTTTCCTTTGTTTGTTCCTTGTGATACTTTTGTTTTTGGACGGGCAATAGATCAGAATGTTTTAAAACTTATCAAAAAAAAAAAAAGATCAGAATGTTTTAAGAG
GTGCCTAACAAAAAGAAGGGGTGTGGCCCATGGACAGATGATGTATATAAGAAGTGCTCAAAAAACTTGCTTACAACACTACTAATCTAACCAATCCTCCCACTGTCTACAAAGCCCAAG
AAAGGCAACAAATAAAGTCCCTTATCCCTGCCTGACCACCGAAATAATGACTTGAGAACCATATCTTTCAGCTTCATGCAAGACCTTTCCAATCCTCCACACATTCCTCTATTGTGCTCC
TTGAACTCTGCAGTCTGCATGTTTATTGGTTGTTTTATGTTATTGATTTTGCTTCTATTAGAATGTATACAATAAACAATTGCAAACATTGCTTACTTCCAATGGGACGTGAGTTGAAAA
TTGGTTGACAATCAATTAATGAACTAGTCTAGTAATGATAATAATGAACTCTGAGGAATTTAATTCAACTGTTGTTATTTGACAGAAAGATGGACCAGGGGCACCAGGAGGACAGTCCTG
GACAGTGCAATGGCTGAAGTTTGATAATTCTTACTTCAAG
GTGTGGAACCAGAACAACCTGTATTATTATTTAAGGAAAGAAGACCTGGGTGTTTTGGTGGATTGTGGGGAAATATAGAA
CTTCATTTTGCTGATTGTGTGTGATCTTATGTAGGATATCAAAGAAAAAATAGATGAAGAACTACTTGTGTTGCCAACTGATGCTATTCTTTTCGAAGATCCATCTTTCAAGGTAAAACA
GATTGATGTTCTGGGGAAGCCAGTTATGGTGTGCATCATCGTTTATTTTGTTTTATTTTTTATTTTTTTAATGAAATGTTGCATACTTGGCAGGTATATGCTGAGAAATATGCGGTAGAT
CAAGAAGCATTTTTCAAAGATTATGCTGAAGCCCATGCAAAACTCAGTAACCTTGGAGCTAAATTTGATCCTCCTGAG
GTTTGTTAGCCTTTGGTGCTTGTGCAATTTGTTTCTATTCAC
AGCATTCTTCAAAAACTTTAGCAGATTCTAAATATAGACCAATTTCTGAGGCCCTTATGCCATATGCGTTTCCAGGGAAGCATTACCCTTGTTATTTTTCTGGCATGTATGGTCCATCTG
AGTTCAAATCATTTCTTGATCTTATTCTTTTTTGAAATTATTCCCAAATGTCTGGCCAAATGCTGCTTGTTTGAACTGGCATCTTTTGTTTTCATAACTTCTTCTCAATGAATTTCGGAA
TTTAAAGACATTTTTTATGCCAAAATAACTCCTCGATACCAATTTTGCACCTATGCTGGAAATAATTGAAGTGATTTGTTCTGTTTGCTTTATGGTATGTTAACAGTTTCTTACCCCATC
CCAGCCTTCTCAGGAGACACAAAAGCATGCAACCCCAACTCCCTGAACAATTATTAACCATCCTGTTTTCTTAAAAATTTCTTCAACATCAGTATACTCAATCTTTTCTATTGAAAAAGG
AAAAAGGAAAACGAGGAATTTGGTGGTTTATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTGAATTTGGTGGTTTATTTAAGAA
ACTGTTATGGAATTTGCTGAACAGGGTATTGTGATAGATGATGGTCCTGCAGAAGCTGCACCAGAGAAATTTGTGGCAGCCAAGTATTCATCCGGGAAGGTTAGATCTTTTCTCCTAATT
TTCTTTTAGTTAATGGTTGTCAAGAATATATTGCATTTTCCTGATTTAAAGACTCTAATGAAGGAACTTGTATGTGTGCAAATTGTTCATCTCTTCTGGTTCACATGGTTTGGTGCAGGA
CTAAAACAAGTGTCATGTTTCTTTTGCCGTATCTTTAATAACACAAGATGAAGCTATTTTCAAATTCTGTGAACACACATCTAAAACTTGGAAGTCTAAATGAAGGAGAAAGGAATAAGA
TTCAATAGTGTTGCCTATTTGAATTGCAGAAAGAGCTGTCAGAGGCTATGAAGCAGAAGATTCGTGCAGAGTATGAAGCAGTTGGTGGAAGCCCAGATAAGCCTCTCCAGTCCAACTATT
TTCTAAATATCATGATTGTGATTGCTGTTTTGGCATTTTTGACAACTCTGTTTGGAAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCTGAGTGGCGCCGCCGCGGCCTCCTCCCGCCTCCTCCCCAGAGCGCGGCTCGGTTTTTCAACTTCGTCTTCAACTCCTTCTCCTTCTTCACTCTCCCTTTCCTCTCTCAAA
GGCCTCCGATCCTCTCCTCTGCTCTCTCACCTCCTCCACCGTCAG
NNNNNGCAGAAAACGACTTCGGTCCGTGCATCCAGCGGTGGCTTGGGTTTCAGCTCCGTGGCGGCTCCGAAATGC
TCGGCATCCGATCCGGATCAGCTGAAGAGTGCTAGAGAAGACATCAAGGAGCTTCTCAAATCTAAATTTTGTCATCCTCTTTTG
GTTCGCCTAGGATGGCATGACGCAGGTACTTATAAC
AAGAACATTGAGGAGTGGCCTCTAAGAGGTGGAGCAAATGGAAGTCTGAGATTTGAAATTGAGCTGAAACATGGGGCCAATGCAG
GTCTTGTTAATGCAGTGAAACTTCTTCAGCCTATC
AAAGACAAGTATTCTGGTGTGACATATGCAGACTTATTCCAATTGGCCAGTGCTACTGCCGTGGAG
GAGGCTGGCGGACCCAAAATCCCCATGAAGTATGGAAGGGTGGATGCTTCAGGA
CCTGAACAGTGCCCAGAAGAAGGGAGGCTTCCTG
ATGCTGGCCCCCCTTCACCTGCTGATCATCTACGTGATGTTTTCTACAGAATGGGGCTAAATGACAAGGAAATAGTTGCATTATCG
GGTGCACACACGCTAGGAAGGTCCAGACCGGAACGCAGTGGTTGGGGAAAGCCGGAGACTAAGTATACG
AAAGATGGACCAGGGGCACCAGGAGGACAGTCCTGGACAGTGCAATGGCTG
AAGTTTGATAATTCTTACTTCAAG
GATATCAAAGAAAAAATAGATGAAGAACTACTTGTGTTGCCAACTGATGCTATTCTTTTCGAAGATCCATCTTTCAAGGTATATGCTGAGAAATAT
GCGGTAGATCAAGAAGCATTTTTCAAAGATTATGCTGAAGCCCATGCAAAACTCAGTAACCTTGGAGCTAAATTTGATCCTCCTGAG
GGTATTGTGATAGATGATGGTCCTGCAGAAGCT
GCACCAGAGAAATTTGTGGCAGCCAAGTATTCATCCGGGAAG
AAAGAGCTGTCAGAGGCTATGAAGCAGAAGATTCGTGCAGAGTATGAAGCAGTTGGTGGAAGCCCAGATAAGCCTCTC
CAGTCCAACTATTTTCTAAATATCATGATTGTGATTGCTGTTTTGGCATTTTTGACAACTCTGTTTGGAAACTAG

Retrieve as FASTA