Entry information : VvAPx07 (GSVIVT01009079001)
Entry ID 5174
Creation 2007-04-12 (Christophe Dunand)
Last sequence changes 2007-04-12 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: VvAPx07 (GSVIVT01009079001)
Name (synonym) VvAPx07 (GSVIVT01009079001)
Class Ascorbate peroxidase    [Orthogroup: APx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Vitaceae Vitis
Organism Vitis vinifera (Grape)    [TaxId: 29760 ]
Cellular localisation N/D
Tissue types Berries
Inflorescences
Leaves
Pedicel
Pericarps
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VvAPx07
start..stop
S start..stop
CclAPx01 585 0 1..344 1..349
CpapAPx06 578 0 1..344 4..347
MeAPx02 569 0 1..344 1..349
PpeAPx05 565 0 1..344 1..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4772172..4772258 87 N° 2 4771985..4772083 99 N° 3 4771063..4771147 85 N° 4 4770937..4770971 35
N° 5 4770735..4770800 66 N° 6 4770590..4770630 41 N° 7 4770205..4770335 131 N° 8 4769629..4769735 107
N° 9 4768030..4768167 138 N° 10 4766966..4767100 135 N° 11 4766006..4766116 111  
complement(join(4766006..4766116,4766966..4767100,4768030..4768167,4769629..4769 735,4770205..4770335,4770590..4770630,4770735..4770800,4770937..4770971,4771063. .4771147,4771985..4772083,4772172..4772258))


exon

Literature and cross-references VvAPx07 (GSVIVT01009079001)
Literature REFERENCE 1 Reid,K.E., Liao,N., Peng,F., Schlosser,J., Kirkpatrick,R., Shukin ,R., Barber,S., Holt,R., Siddiqui,A., Jones,S., Marra,M., Bowen,P., Bohlmann,J., Martinez Zapater,J.M. and Lund,S.T. Expressed sequence tags from grapevine (Vitis vinifera cv. Cabernet Sauvignon). REFERENCE 2 Velasco,R., et al., The first genome sequence of an elite grapevine cultivar (Pinot noir Vitis vinifera L.): coping with a highly heterozygous genome.
DNA ref. Phytozome 11:   chr18 (4772258..4766006)
Cluster/Prediction ref. UniGene:   Vvi.6867
Protein sequence: VvAPx07 (GSVIVT01009079001)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344
PWM (Da):   %s   37350.89  
PI (pH):   %s   6.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVSFLSTAPSLIPMAPQPSSTPRHSLQAGRIRCNRIECNGTDEDGFRRRDVLKCVGATLGMELLASSGPFVEMAAAADLIQLRQRSEFRSNVKGTLFTAIGNPDIIPSLLTLALNDAMTYDKATKSGGPNGSIRFSSEISRPENKGLSAALNLLEESKKEIDSYSKGGPISFADLIQYAQSAVKSTFIASAVRKCGGNEEKGNLLYTAYGSNGQWGLFDKQFGRADTQEPDPEGRVPQWEKASVQEMKDKFTAVGFGPRLAVMSAFLGPDQLASEALLATDPDVAPWVQKYQRSRETVSQTDYEVDLITTLTKLSCLGQQINYEAYSYPVQKVDFSKLKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 4, 10 introns, incorrect prediction with FGENESH) and 21 ESTs. cultivar="Pinot Noir", "Chardonnay", "PN40024" and "Cabernet Sauvignon". Also found in AM471991 (BAC end).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGTGTCCTTCCTATCAACAGCTCCGTCTTTGATTCCAATGGCGCCCCAACCATCTTCTACCCCCAGACACTCTCTTCAAGCAGTGTGTATTTTTCTCAATTTTTTTTTTTTTCTG
ATTTCCTTAACTTTAAACATTCTAGAGCACTATTAATTTGGAATTGCAACATCAGGGGAGGATCCGTTGTAACCGAATTGAATGTAATGGAACTGATGAGGATGGATTCCGTCGGAGGGA
CGTTCTCAAATGCGTGGGTGCCACCCTTGGCATG
GTGAGACTACTCCTTCTTAACCCTTTTCTTCAATTTCCCAGTGCTTCCTTGTTTCATGATACAACATTGCCAACTCTGCAACTTGT
GGATTTGTCAATTTTTATTTTATTGTTGTGGGAAAAAGGGTTCGAAACACTATGATCCTTGAAACAGAGATGGGTTTAATTTGGCAGTCTCATGAATCCATAGTTAGAAAAACACTCAAA
TTTTAAAATAGATTTCAGTTCTTATGAGACTGCAGATGCCAATGTCTTCTACTGCTTTAAATAGCTGTTGATAGTAAAGATGACTCAAAATTACTACTAATTTCCTGCCTGCAAATTTGG
TTAAAATCTATGTTTCTGTTGACCATCCTCCCAAATTTTATGAATGGTGGCACAGAATCAGTGTTTCCATAATAATTGGATTTGTAGGGTCAATTAGAAATTTGTTTATGCAGTTGGTGT
ATCAGAAATGTTAATTCTCTAAGTTGGCAAATCCTGTAAGTAGTTTGTGCCTCTTCTGCTTGACACCAATCTACTTTTTTAAGTCCCTGCTGCATTTCCCTCTTTGTGTAACTTGCAAAA
AATTGCTTATCTTACTATTTCTGGTTTATTATTTCTCTCACTTCCTTATGTCAAATAAGCACTGTTTGCAATAACCAAGGCAAAACCAATGCTGATTTAAATGGCTTTCAATAATCTGGA
CAAGACATACGCTTGCTACTAAACGTGCTTCTGAACATATGCAGATCTATATAAGTATGTATTTCTATGGTTTAGTGCCTCTAGAAGAATATAATACTATGGTTTAGAATGATATGATGA
TGAGTTTCTGCCAGCTGTAATCACTCCTTAGGAATTACTAGCAAGCTCAGGACCATTTGTTGAAATGGCTGCTGCAGCTGATTTAATACAACTCAGACAACGTTCTGAGTTTCGTTGTAA
GTTCTCTAAATACCTCACCTTCTCTGGTAAGCTTCCTAGATTCAACAAGAACTGAATGTTCCTTTTTCTTTTTCATTTCCTTAACAGCGAATGTCAAGGGGACCCTTTTTACTGCTATAA
AG
GTAAATTCTTCTGCCCTGGTTTATATCAATGATTTTGGTGTACCTAGTTTTTTGGCCTCATTTATAGACTTAAATTCAATTGATCATACTCTTGGCGGGGCAATTTTTTCACTAATTC
TATCGTGCATATATTCAGGGAAATCCTGATATCATCCCATCCCTACTAACTTTAGCACTGAATGATGCCATGACTTATGATAAGGTCAGGCCAAAAACAAACTTTCTGAAACTTCATACT
CTGTTGGAGTCTTTTACTTTGTATGCAACAAATGGAAAAAACTTATGGGCTCTTGATTAAATTTGTAGGCTACAAAATCTGGAGGCCCAAATGGATCGATACGATTCAGGTAATATAGCA
ACACCTTAAAATATTTATGGTACTCAAAAGATGAAAAAAGAGTATTTTCACATGCTTAAAGTGAGGTCAGATGCACTTGTCATATCCTGTGAGCATTTTTAACACAAAATTTGGACAATA
AGGAATAGGCATATCGTTTTGAATTTCCAAATATTTTGGTTTATGAGTTTAAGTTGTAAAGCATTCTTCTCATTCAACCACTACATTGATTTTGTTCTTGTTCATAATTTTTCTTGCTTG
AAGTTCAGAGATAAGCAGACCTGAGAATAAAGGGCTCTCTGCAGCTTTGAATTTATTAGAGGAATCAAAGAAGGAGATAGATTCATATTCCAAGGGAGGGCCAATATCATTCGCAGATCT
CATCCAATATGCAG
GTTAGACATGTTAATACTCAGGACTATATACATGGACAACACTAAAATACTCGGGACTCGTCCTTTAGCAGTTTGATTAACTGTGTTTTAATGAAAATCAAGTTTG
CACACACATGCACAAGATGTACTCTCAATGTGTAGCAAGATGTATCACCAAAAGTGATGATAAGGCCACTAGTCAGTGTGGATCTCAATTTGCGGTTCTAGGAGGGATAGAAGAACAAAG
CTAAAATTCCCAACATTTTTCTGAAGTGGCCACACAAAAACTTGAACATTTGTTTTTATGCTTAGTGACCCGACAAGTTACCATCAGATTGAAATGCCAAGAAGACTGGTTTCTACTTCT
ATGAAAACAATAACAGATTCATTTTAGATGCTGAGAAAAAGAATGTTTTGATTTAGTCTGCATGTGGCATTTAACAAATTAATCATAATGCCCCTAAATTCAGTTTTTCTTTATCCGACG
CAGCTCAAAGTGCAGTAAAGTCTACATTTATAGCTTCTGCAGTACGTAAATGTGGTGGGAATGAAGAGAAAGGGAATTTATTATACACAGCATATGGCTCAAATGGGCAGGTTTGTTTCT
AAATTGGTGTTGTGATATGCATATAATTCTAACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNTAATGAGTTTTTAAAATAGTGTAAATTTTCAAGAGACTGTTTTGAGTTCGATTTATTGGAAACCTTATCATGTTTTCTTGGGTTTTTCAAAGA
TAAGTTTTACTATGAGTGAGAAGAAAAAGATTTGGTGAAGAATAAGAATCTAATGGATCAAGGATTATTTCAAGGGGAAAACACTACTCTGGAAAGTGACTGTTGTATTAGATATGCATG
TAACTTTCCTATTAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGATATGCACATAACTTCGATCATGTTCTTCCTGTATGGTTATTTCTTCCGTTCCAGCGGTATAAGCATAT
TTTTCTACCCACTTATGAGCTATGGTGAGTTTCTTATGGTCCTATTTTTCCTCTCTCAACCAAACCAGTTGTGAGTGCATGAAGTAGGCCTGGAGAATGGAAGCTAGCATCTCATAAAAA
TTGCATGTATGTTCATGAGTTTGGTCTACACATTTTATATCTACTGATAGAGATCATCATTTTTTTCCCCTCTTAATAAAAGAGTCATGGAGTTGTAGATGTATGTGTGAAATTGTACTT
TGTTTTAACAGTGGGGGTTGTTCGATAAGCAATTTGGGAGAGCTGACACTCAGGAGCCAGATCCGGAGGGAAGAGTTCCCCAGTGGGAGAAAGCTAGTGTCCAGGAAATGAAAGATAAGT
TCACAGCTGTTGGCTTTGGTCCTCGCCAG
GTATTTTCTTCAAACATTTTCAACACCAAAATTGCATTTTAGGGTCTTGTTTTTATTATAGCATGACCTTTTCAAATATAAATTTGGGCCA
GCAAACTGTCAGCCTACCATTTCTTGAGCAACCATGAATTTCAGCTCTGTAGTTTCAAACGAAGGAAAAAGATTATTTGTCGCATAGATTATAATCATGCTGCAAAGAAGATATGCTGTA
ACCTGACAATACAATATCAATCCAAACTTGACTATGATTCCTGACTTTCAAATATAAAATTAATTATATAATTTATATTTGCACAAGCTTCAATGGCTAATGTCAGATTTGTTTATCCAC
CCAAGAGACACTGAACTGCATAAAACACGGACCAGAACCAGTCATGCACCATAGATTGGTATATGGGATTTGTTTTTCCAGCCGAAAAATAGTTGGGAAGACTTTAAATAATGGTATTAA
AGGATTTGTTTTTCCACCATTTGCCAATCCAATTCTTTACAAACCATTTCTTAAAATGAAACATATAATTTAACTTTTACTCACTTCAGTAACTCTCCTTGCCCCATTTGGCAGCTTCAA
CTTGAACTAATTGTCATCTTCTTGAATTTCTTTATTTAAGCTTAATTTGAACAGCTTATTGTGATTTGCATCTGTACTCATATCTAATCCTTCATGGATGTATGCTGCATTTCTTTTTAT
GCAAATGATCCACACTAATCCAAGTTTCTCTTTCAGTAAACCAATTTAAAAGATGAAATTTAAAGAGCTAAAATTAAAATTACATGTAAAGGATCTTACTAGCAGGAAAAAAAGAAAAAG
GAAAACCTGTTAAGGATATTCTACACCTGTGTAGAGGAGCTTCATTGATTACTATTGATGACATACTGAGTCATATTAACTGACCTTGTTCTTTTCTTTCTCTTTCTGGGTTTGCCAGCT
AGCTGTTATGTCTGCATTTTTGGGTCCAGATCAGTTGGCAAGTGAGGCCTTATTAGCCACGGATCCAGATGTTGCTCCATGGGTTCAGAAATACCAACGCAGCCGAGAAACAGTTTCTCA
GACTGATTATGAG
GTCAGTAACTTGATGGTTTCCTCTTTTTCCTCTACTTTTGAATTGGAAAATGGACAAAAATAGATATTGTTCATTGACTTGTCAAGTTTTATAGTGGGGAAAAGAAT
AAAAAGAAGGAAACATCGAGGACTATGCTTGATATACTTCTCTATAGCATTCTTTGATGCCCCCTTTGAAGATTAAATTCTCATTGCTTGGCTTTGAAATTAAGACCAAATTAATTTNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNGCTAAAATGATTTGGTGGAAGAATTTTGATCCACAATATGTAGTTCAACTCATGATGATTAATTTCTTATTATGCTTCATCAACACTNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCAATTTTGGG
TTTGGAATTTTTTTCTTTTCAGGTTGATCTTATTACCACTCTCACAAAATTGAGTTGCTTGGGCCAACAAATCAACTATGAGGCATATAGTTACCCTGTCCAAAAGGTTGATTTTAGCAA
GCTCAAACTATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGTGTCCTTCCTATCAACAGCTCCGTCTTTGATTCCAATGGCGCCCCAACCATCTTCTACCCCCAGACACTCTCTTCAAGCAGGGAGGATCCGTTGTAACCGAATTGAATGTAAT
GGAACTGATGAGGATGGATTCCGTCGGAGGGACGTTCTCAAATGCGTGGGTGCCACCCTTGGCATG
GAATTACTAGCAAGCTCAGGACCATTTGTTGAAATGGCTGCTGCAGCTGATTTA
ATACAACTCAGACAACGTTCTGAGTTTCGTT
CGAATGTCAAGGGGACCCTTTTTACTGCTATAAAGGGAAATCCTGATATCATCCCATCCCTACTAACTTTAGCACTGAATGATGCCATG
ACTTATGATAAG
GCTACAAAATCTGGAGGCCCAAATGGATCGATACGATTCAGTTCAGAGATAAGCAGACCTGAGAATAAAGGGCTCTCTGCAGCTTTGAATTTATTAGAGGAATCAAAG
AAGGAGATAGATTCATATTCCAAGGGAGGGCCAATATCATTCGCAGATCTCATCCAATATGCAG
CTCAAAGTGCAGTAAAGTCTACATTTATAGCTTCTGCAGTACGTAAATGTGGTGGG
AATGAAGAGAAAGGGAATTTATTATACACAGCATATGGCTCAAATGGGCAG
TGGGGGTTGTTCGATAAGCAATTTGGGAGAGCTGACACTCAGGAGCCAGATCCGGAGGGAAGAGTTCCC
CAGTGGGAGAAAGCTAGTGTCCAGGAAATGAAAGATAAGTTCACAGCTGTTGGCTTTGGTCCTCGCCAG
CTAGCTGTTATGTCTGCATTTTTGGGTCCAGATCAGTTGGCAAGTGAGGCC
TTATTAGCCACGGATCCAGATGTTGCTCCATGGGTTCAGAAATACCAACGCAGCCGAGAAACAGTTTCTCAGACTGATTATGAG
GTTGATCTTATTACCACTCTCACAAAATTGAGTTGC
TTGGGCCAACAAATCAACTATGAGGCATATAGTTACCCTGTCCAAAAGGTTGATTTTAGCAAGCTCAAACTATAG

Retrieve as FASTA