Entry information : GmAPx-R (Glyma06g07180)
Entry ID 5182
Creation 2007-08-22 (Christophe Dunand)
Last sequence changes 2010-08-13 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmAPx-R (Glyma06g07180)
Name (synonym) GmAPx-R (Glyma06g07180)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Leaves
Seedlings
Stems
Whole plant
Inducer Salicylic acid treatment
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx-R
start..stop
S start..stop
LjAPx-R 495 1e-178 9..319 8..317
MtAPx-R 477 1e-171 9..319 11..320
VvAPx-R 417 1e-147 4..319 5..330
CsAPx-R 416 3e-147 24..319 30..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5211573..5211708 136 N° 2 5211791..5211899 109 N° 3 5211993..5212120 128 N° 4 5212901..5212971 71
N° 5 5213140..5213182 43 N° 6 5213265..5213361 97 N° 7 5213673..5213756 84 N° 8 5214449..5214570 122
N° 9 5214878..5214944 67 N° 10 5215741..5215843 103  
join(5211573..5211708,5211791..5211899,5211993..5212120,5212901..5212971,5213140 ..5213182,5213265..5213361,5213673..5213756,5214449..5214570,5214878..5214944,52 15741..5215843)


exon

Literature and cross-references GmAPx-R (Glyma06g07180)
Literature Shoemaker,R., et al.,. Public Soybean EST Project
DNA ref. Phytozome 12:   Gm06 (5211573..5215843)
Cluster/Prediction ref. UniGene:   Gma.16394
Protein sequence: GmAPx-R (Glyma06g07180)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319
PWM (Da):   %s   34092.45  
PI (pH):   %s   7.78
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLGVSVSVRCSIGTASGNTQTDYPAKFQRSSFSTANFLPDNASSDLAVSISSSSSRRGLIRIATLPCLLPLIGCLPANAMQPGSKEYLLIKEEVRKVLSKGKAAGVLRLVFHDAGTFDIDDSGGMNGSIVYELERPENAGLKKSVVLQKAKTQIDAIQPVSWADMIAVAGAEAVEVCGGPPIQVSLGRLDTLVPDPEGRLPEESLNASGLKKCFQSKGFSTQELVALSGAHTIGSKGFGSPISFDNSYYKVLLEKPWTSGGMPSMIGLPSDHALVEDDECLRWIKKYADSENLFFEDFKNAYVKLVNSGVRRNSL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 9 introns) and 8 ESTs (Unigene and two TGI: TC232761, TC220505) + EV275649. Cultivar="Williams", "Kefeng 1" and "Harosoy".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGATTAGGTGTGAGTGTGAGTGTGCGGTGCTCAATCGGCACCGCTTCAGGCAACACCCAAACCGATTATCCCGCCAAATTCCAACGGTCATCTTTCTCAACTGCCAACTTCCTCCCC
GACAACGCTTCTTCAG
GTAAGGGAGGCAACCTTCAACCTCGGATGGAGCTGCTGTTATTGTGCTTATACTTTAACTACACGGTAACCGTTTTTCGTAGATTTAGCAGTTTCAATTTCGAG
TAGTAGCAGCAGGAGAGGGCTAATACGCATAGCCACGTTGCCATGTCTTCTTCCCCTCATAGGTTGCCTCCCAGCCAACGCCATGCA
GTAAGTATGTATATAATTAAAATTTAATTTTGG
ACCATACATATTACATATTCATTCATGTCTTGAATAGTGAATACATGGTGGTGATTGAAGGCCAGGTTCAAAGGAATATCTTCTCATTAAAGAAGAGGTGAGGAAGGTCTTGTCCAAGGG
AAAGGCTGCTGGCGTGCTTCGATTGGTATTCCATGATGCCGGAACCTTTGACATCGATGACAGTACAG
GTAGTATTCTTATCTCATCTGAGGGACTCAAGGTTGCTGTTATTTTTCATAC
AGTCCTTCTACTCTCTTTTATGACCAGAGTAAAACATTTGTCTGAAAAATGAATAGCCATGTTTTCTCAGTGTCAAACAAACAGAAATAATCCTCGTTATGACTTTAAAAGTAGTTATTA
TACATAGCAGTTTGTAATTGGATTGGATGACAGTATAATAACCTTTACACGATCAGTGCATATATTATGTTTTTCCCGTTAAATATGTAGCTAGTCCACATTTGGGGTGCCAATGCCATT
TGTTTTGACTTTTTTACCTGATATAATTAAGCTTGCATCCTCTACTTGATATGCTTCCTTAATCATCCAATTTGGCATCAAGAGCCTAACTCTAAAACTAAGTAGAATTCCAAGCTGAAT
TCGATTTTGAGTCTTACAGGAAAAAATGCCAATCATTGCTATCATGGAGACAAACCATGCTAGTAACGTAGTGATGGCTTTTTCAGATATGTCTCATTGCTGGTCCTTTTCAAACAAAAT
TATCCTGTGACTTTTCTCCTATGTAATGAATAATCAAATGGAAAATTTCCCATCTTTCTCTTTTCTATAACTCCATTTTAGTAGTAGTTCTAGCCTTTGCTCATCGATTGAATTTGTTTA
GGTAATTTTTCACAAGGCGTGAGCCAATTATAGAGGAAGCTGTGCGGTATCTTATTATGTTTTCTTGGTAATAGTGTCATCATCAAATTCAAAATGTACATATATTTTTTGCACTTTTCA
TGTTGCAGGTGGTATGAATGGTTCTATAGTCTATGAACTTGAAAGACCTGAAAATGCTGGCCTGAAAAAATCAGTAAAGGCATGCTCTGTCTCACTTTTTTCTCATTCCCCTTCTACCAC
TTCTATTTCTATTACTATTTGGAGAATTCCACATGATAGTGAGGTAGTGATGGCTTTAAGACAAATATCTTTTCTTACATTTTAACTGCCACCTAATATCTCAGTGGACGTATCACATAT
TTTTTAGGTTCTGCAAAAAGCAAAGACTCAGATAGATGCTATCCAACCAGGTCCTTCTTCTATCTGGTAACTGCTGCTAATAGTAAGTGATAATTTGGTCTGGATCAACAAATTTTCGTT
TATCTTTATTAGTATCTTGGGCGGACATGATTGCTGTGGCTGGAGCTGAAGCAGTTGAAGTATGTGGAGGTCCACCTATTCAAGTTTCACTGGGCAGATTAGATACACTGTAAGATGCTT
GGTTTCTAGTTGACTTGTTTTCAAGTTAGTACTTATGAAGTATGATGTGACAAGCAACTGGTCTTTTCTTAACAGGATGACAAACAAACAGTTATATGTTAGTTTTGGTGCATTAGGTGC
TCTGAAAATGTTTTTTAACCAATTATTGAATTATGTTCAATCTGTTTGTTTAATGAATGATCAACCATTTTGCTGGGAATAAAAATTTCCTCCATGGGAATTTAACTCATTGGTTTTCAT
ATAACAATGAAGTCTGGTTAGTCTTCAGTCAAATAATATTTTCATTCATTTTAATGATAGGGTGCCTGATCCAGAAGGGAGACTTCCTGAGGAATCTCTCAATGCTTCTGGTTTGAAGAA
ATGTTTCCAGAGCAAAGGCTTTTC
GTGAGTATGAGGAAAAACTCCTAATTTACCTTGTATTTGTGTTCTATAAAGTATCATTTATTTGTATCTATTTTAGACTAGTGCAGCTATACATCA
TCTAAAAACTGTCTGATTGTCCATAACATGAGAATCTTAAGATTACAAAGGCAGACTGAATCTTATACTACCTCCGATCCTATATATAAGAAACAATTACCTAATTCATAAACACCAATA
AAAGTAGTTAGATTAGTTAATTTGTCATAAAATTTTATTTTATTTCAAGACTACCCATAATATTAGATGATTTAAGAGGTGAATATTTTTTAAAAAATAATTTTTCAACTAATGAGTGTC
TCTTATTTTGATGATACCTCAATAAATGCACCCACTTTGATGGAAAAATGATTATAATCATTAATAGACCTCACAATAATTAGGGGTCAAAAGCAAATTTAGCAATAAAGTAATCTTATG
TTTCTTATAATTAAGACCAAGAAAATGTTACATTTTGTTTCATATATAGAGGATTAGAGGTAGTATCTTATAAAGTCCTAATTCTAAACCAGACTAACAAGGCAAGAAAATAGTGATTTT
CTGTCCCAAAAATTACTTATCATATGTTTATTAGTCATTGTATAAATTTTATAAAATATTTTACTTGAATTAGTTTTGCTTATGCATCCTTATCATTTGGAGCTTTTCTTTCATAGAACA
CAAGAACTTGTGGCTTTGTCTGGAGCCCACACTATTGGAAGTAAAGGTTTTGGAAGCCCAATTTCTTTTGACAATTCATATTATAAGGTTCTTTTGGAGAAGCCGTGGACGTCTTCAG
GT
AATTTAACAGCTTATCTCATTTAAACATTGTTTTTATATTTTTTTTGTATACTTGCTACAAGTCGTTGTTTTCTGAAGACAATAAGGAAATGCAAGAGTTGAATGGATGTTACTATGTTA
GGCTTAGCCATTGGATTATCACATAATTTTTGTCCAGTCTTCTCTGGATATGTTCCAATCAACAGCTCTACTTTGCGGTTGCATGCTCATTTTTCTGGATAGACCCAACATATTTATTGG
TTTGTTTTTGTAAAAAAAAAAAAATTATTTGTATAATTCTCATCTGCTGGTTGTCTTTTATGCAGGTGGTATGCCGAGTATGATTGGGCTTCCTTCAGATCACGCTCTTGTTGAGGATGA
TGAATGCTTAAG
GTTCTTTATCTTTGACAACCTCTTATGCTACTCTTAATATGAATTTGTCCCCCACTTTTTTTCTTTTCTGGCTAAGCACTAAAATTTTAGTGCTGAAGTGGTAAATCC
TTTAAAGAATGTTAGGTTATCTAAACAGGTAAAACAATTAAAATGAGAAGCATATCCTTTTCTTGTTTTTCAGGATTCTATAAAATAACAGGTAACGCAAATAATCCATCAATTGGAAGC
AAATAATCTCTATCAATTGGTAGTGAATAAGTTATGTTAGTTATATTTGTCTGACAGTCTGACACCATAATTCGTGATTCATCGTGTCTTGCCCTAGTACACCATATCCTTGTCTCTGGA
GTACTAGTTTACACACAAAACTAAACATTGAATTTTCCTTTTCTAGACCTCTAGTTGAAATCTGAAACATCAATTTTCAAACAGTTAGGTGATGATCCCGAGCCTAACGCATGTTCTTGT
TCAAATTCTTGTATTATAGTTGTTTGTTGGCCTCAGGACTCATTTCTGATTCTTTTTTGTCCATGTAAGCAAACAATGACGTGCTGAAAAGAAAATTGTCTTTTTAAGTAAGCTAGAGTC
GGTATTGTCTATCAAAAACTCCCATCAATCATGTATTTAGGAGGGGGAAATTTTAACTAAAATTTTTAGCTGGACCATTTTATTATATCTTAATGATGACTAGACATTCACTTGCATGTT
ACATATCCCGGTGCACCGCATGTGTATGTTTCTGCTGATTATATGTTCCTTAGTGTGCATAACTAAGAGAGCTCCATTGATTGAACAGATGGATTAAAAAATACGCAGACAGTGAGAATC
TATTCTTTGAAGATTTCAAAAATGCGTATGTCAAGCTGGTGAATTCTGGTGTGAGGCGGAATAGCTTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGATTAGGTGTGAGTGTGAGTGTGCGGTGCTCAATCGGCACCGCTTCAGGCAACACCCAAACCGATTATCCCGCCAAATTCCAACGGTCATCTTTCTCAACTGCCAACTTCCTCCCC
GACAACGCTTCTTCAG
ATTTAGCAGTTTCAATTTCGAGTAGTAGCAGCAGGAGAGGGCTAATACGCATAGCCACGTTGCCATGTCTTCTTCCCCTCATAGGTTGCCTCCCAGCCAACGCC
ATGCA
GCCAGGTTCAAAGGAATATCTTCTCATTAAAGAAGAGGTGAGGAAGGTCTTGTCCAAGGGAAAGGCTGCTGGCGTGCTTCGATTGGTATTCCATGATGCCGGAACCTTTGACATC
GATGACAGTACAG
GTGGTATGAATGGTTCTATAGTCTATGAACTTGAAAGACCTGAAAATGCTGGCCTGAAAAAATCAGTAAAGGTTCTGCAAAAAGCAAAGACTCAGATAGATGCTATC
CAACCAG
TATCTTGGGCGGACATGATTGCTGTGGCTGGAGCTGAAGCAGTTGAAGTATGTGGAGGTCCACCTATTCAAGTTTCACTGGGCAGATTAGATACACTGGTGCCTGATCCAGAA
GGGAGACTTCCTGAGGAATCTCTCAATGCTTCTGGTTTGAAGAAATGTTTCCAGAGCAAAGGCTTTTC
AACACAAGAACTTGTGGCTTTGTCTGGAGCCCACACTATTGGAAGTAAAGGT
TTTGGAAGCCCAATTTCTTTTGACAATTCATATTATAAGGTTCTTTTGGAGAAGCCGTGGACGTCTTCAG
GTGGTATGCCGAGTATGATTGGGCTTCCTTCAGATCACGCTCTTGTTGAG
GATGATGAATGCTTAAG
ATGGATTAAAAAATACGCAGACAGTGAGAATCTATTCTTTGAAGATTTCAAAAATGCGTATGTCAAGCTGGTGAATTCTGGTGTGAGGCGGAATAGCTTATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTGTGTGGCG TCAGGTAGAG ATAATGAGAT TAGGTGTGAG TGTGAGTGTG CGGTGCTCAA TCGGCACCGC TTCAGGCAAC ACCCAAACCG ATTATCCCGC CAAATTCCAA CGGTCATCTT  TCTCAACTGC CAACTTCCTC CCCGACAACG CTTCTTCAGA TTTAGCAGTT TCAATTTCGA GTAGTAGCAG CAGGAGAGGG CTAATACGCA TAGCCACGTT GCCATGTCTT CTTCCCCTCA  TAGGTTGCCT CCCAGCCAAC GCCATGCAGC CAGGTTCAAA GGAATATCTT CTCATTAAAG AAGAGGTGAG GAAGGTCTTG TCCAAGGGAA AGGCTGCTGG CGTGCTTCGA TTGGTATTCC  ATGATGCCGG AACCTTTGAC ATCGATGACA GTACAGGTGG TATGAATGGT TCTATAGTCT ATGAACTTGA AAGACCTGAA AATGCTGGCC TGAAAAAATC AGTAAAGGTT CTGCAAAAAG  CAAAGACTCA GATAGATGCT ATCCAACCAG TATCTTGGGC GGACATGATT GCTGTGGCTG GAGCTGAAGC AGTTGAAGTA TGTGGAGGTC CACCTATTCA AGTTTCACTG GGCAGATTAG  ATACACTGGT GCCTGATCCA GAAGGGAGAC TTCCTGAGGA ATCTCTCAAT GCTTCTGGTT TGAAGAAATG TTTCCAGAGC AAAGGCTTTT CAACACAAGA ACTTGTGGCT TTGTCTGGAG  CCCACACTAT TGGAAGTAAA GGTTTTGGAA GCCCAATTTC TTTTGACAAT TCATATTATA AGGTTCTTTT GGAGAAGCCG TGGACGTCTT CAGGTGGTAT GCCGAGTATG ATTGGGCTTC  CTTCAGATCA CGCTCTTGTT GAGGATGATG AATGCTTAAG ATGGATTAAA AAATACGCAG ACAGTGAGAA TCTATTCTTT GAAGATTTCA AAAATGCGTA TGTCAAGCTG GTGAATTCTG  GTGTGAGGCG GAATAGCTTA TAAATTCAGG AGTTGAATGT TCCAACTTCC ACTGAAGGGG CAACTTGCAT TTTTATTGAC TTTCTAACAG TGTTTATGCA CAGTTGCCAT GAAGTTTTGG 
GTGCTTTATT ATTGATTTGA ACATCAAGAT CTACTACCCC CTAAAAATCA ACCAACGAAG TATGTGCATG CAGGGCCAAT AAATnTCATG GAAAAGTCGT TTAAGGGGT 

Retrieve as FASTA