Entry information : BdeCcP01
Entry ID 5238
Creation 2007-04-17 (Marcel Zamocky)
Last sequence changes 2007-04-17 (Marcel Zamocky)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: BdeCcP01
Name BdeCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Chytridiomycota Chytridiomycetes Batrachochytrium
Organism Batrachochytrium dendrobatidis    [TaxId: 109871 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdeCcP01
start..stop
S start..stop
ThybCcP01 408 3e-143 7..357 8..350
AnCcP02 408 4e-143 4..357 18..361
MimpCcP01 407 3e-142 24..357 27..376
MconCcP01 407 3e-142 24..357 27..376
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1540901..1541150 250 N° 2 1540354..1540667 314 N° 3 1540175..1540279 105 N° 4 1539943..1540095 153
N° 5 1539610..1539867 258  
complement(join(1539610..1539867,1539943..1540095,1540175..1540279,1540354..1540 667,1540901..1541150))


exon

Literature and cross-references BdeCcP01
Literature Birren,B. et al., The Broad Institute Genome Sequencing Platform. The Genome Sequence of Batrachochytrium dendrobatidis JEL423. Unpublished
DNA ref. JGI genome:   scaffold_2 (1541150..1539610)
mRNA ref. JGI transcript:   9544
Protein sequence: BdeCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359
PWM (Da):   %s   39156.35  
PI (pH):   %s   8.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLRSVSILRTVARSPITTVVSRYTAPHVRALTTQSSDTKGSSSSGGSNGSSFMWLALGGLVAGSGYYYYTTQDGCAISSKFGAAQKPLDYQAVYNAIAEVMDENDYDDGSYGPVLLRLAWHASGTYDKNTGTGGSNGATMRFNPESAHGANAGLSHARERLEKVKKQFPSITYADLWSLAGVVAVQEGGPDIPWRAGRKDAETSVACTPDGRLPDASQSHDHLRNIFYRMGFNDQEIVALSGAHSLGRCHTDRSGYDGPWSFSPTTFSNAYFKLLFSEKWVDKKWTGPKQAIDKATGTLMMLPTDLAITNDRVFKKQAEIYAKDEGKFFEDFAKAFQKLEELGVPFKPDTPAHVFKRI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). No EST. Strain="JEL423".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCGCTCTGTTTCCATCTTACGCACTGTTGCTCGCTCTCCCATCACCACCGTTGTTTCTCGCTATACAGCTCCTCATGTCCGTGCCCTAACCACTCAATCTTCTGATACAAAAGGA
TCGAGCAGCAGTGGTGGCTCTAATGGCTCTTCCTTCATGTGGCTCGCTCTTGGTGGTTTGGTTGCTGGCTCTGGCTACTACTACTATACTACTCAGGATGGATGTGCTATTAGTTCAAAG
TTTGGTGCAG
GTTAGTGATCTGTAGAGCTTTTCTCGATTCTCCCATTGCCATCCTGACTATCAAAAGATGGTCAAAGTTGCAGAGTATTGCAACTAATAGTATGAATCATGATCTGCTGT
CAGATGCATGTTGCATAAATTTACTCTGTAATGGGACATGTCTATCTTGATATCTCTAATCCCCTGGCCCTACTGAGTGATCTCGAATTAATCCATATGATCTATATGCTATCAATACAA
TAGCACAAAAGCCTCTTGATTATCAAGCAGTTTATAATGCCATTGCTGAGGTAATGGATGAAAACGACTATGATGATGGCTCCTATGGTCCTGTTCTTTTACGTCTTGCCTGGCACGCAT
CTGGCACTTATGACAAAAACACTGGCACTGGCGGCTCCAATGGGGCAACCATGCGGTTCAACCCTGAAAGTGCTCATGGCGCCAATGCTGGTTTGAGCCATGCCCGTGAACGTCTTGAAA
AAGTCAAGAAGCAATTCCCTTCCATCACATACGCAGATCTGTGGAGTCTTGCTGGTGTTGTCGCTGTTCAGGAAATG
GTAATGTGTTGCACTGCCATGCTACCTATAACATAGCTTTTGT
TCAACATGTATTGTTATTTATGGATCTATAGGGTGGTCCAGATATCCCATGGCGCGCTGGTCGAAAGGACGCAGAGACATCTGTTGCCTGCACTCCTGATGGCCGTCTCCCAGATGCCAG
TCAGTCACACGATCAC
GTATGTAGCTTCAGTATCTCTTGCTACACTCTTATTGTATTGCTAACTGTGTTGCATATACAATGAATTCATGCTATAGTTGCGAAACATCTTTTACCGCATGG
GTTTCAACGATCAAGAGATTGTCGCTCTTTCTGGAGCACATTCTCTTGGACGTTGTCACACTGATCGATCTGGTTATGATGGACCGTGGAGCTTTAGCCCCACCACCTTCTCCAACGCAT
ACTTTAAA
GTAAGTTTTCTATTTTATCACATGGACATGGACATGCAGATCTAGCTATTTACCACTCGAATTGTTTGGAAATAGCTTCTTTTTAGCGAAAAGTGGGTCGACAAAAAATGGA
CTGGGCCCAAGCAAGCTATTGACAAGGCTACTGGTACACTCATGATGTTGCCTACTGACTTGGCTATTACCAATGATCGTGTCTTTAAAAAGCAAGCAGAGATCTATGCTAAAGATGAAG
GCAAATTTTTCGAGGACTTTGCCAAAGCTTTCCAAAAGCTAGAAGAGCTTGGCGTTCCCTTTAAACCTGACACTCCTGCCCATGTTTTCAAGCGTATATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCGCTCTGTTTCCATCTTACGCACTGTTGCTCGCTCTCCCATCACCACCGTTGTTTCTCGCTATACAGCTCCTCATGTCCGTGCCCTAACCACTCAATCTTCTGATACAAAAGGA
TCGAGCAGCAGTGGTGGCTCTAATGGCTCTTCCTTCATGTGGCTCGCTCTTGGTGGTTTGGTTGCTGGCTCTGGCTACTACTACTATACTACTCAGGATGGATGTGCTATTAGTTCAAAG
TTTGGTGCAG
CACAAAAGCCTCTTGATTATCAAGCAGTTTATAATGCCATTGCTGAGGTAATGGATGAAAACGACTATGATGATGGCTCCTATGGTCCTGTTCTTTTACGTCTTGCCTGG
CACGCATCTGGCACTTATGACAAAAACACTGGCACTGGCGGCTCCAATGGGGCAACCATGCGGTTCAACCCTGAAAGTGCTCATGGCGCCAATGCTGGTTTGAGCCATGCCCGTGAACGT
CTTGAAAAAGTCAAGAAGCAATTCCCTTCCATCACATACGCAGATCTGTGGAGTCTTGCTGGTGTTGTCGCTGTTCAGGAAATG
GGTGGTCCAGATATCCCATGGCGCGCTGGTCGAAAG
GACGCAGAGACATCTGTTGCCTGCACTCCTGATGGCCGTCTCCCAGATGCCAGTCAGTCACACGATCAC
TTGCGAAACATCTTTTACCGCATGGGTTTCAACGATCAAGAGATTGTCGCT
CTTTCTGGAGCACATTCTCTTGGACGTTGTCACACTGATCGATCTGGTTATGATGGACCGTGGAGCTTTAGCCCCACCACCTTCTCCAACGCATACTTTAAA
CTTCTTTTTAGCGAAAAG
TGGGTCGACAAAAAATGGACTGGGCCCAAGCAAGCTATTGACAAGGCTACTGGTACACTCATGATGTTGCCTACTGACTTGGCTATTACCAATGATCGTGTCTTTAAAAAGCAAGCAGAG
ATCTATGCTAAAGATGAAGGCAAATTTTTCGAGGACTTTGCCAAAGCTTTCCAAAAGCTAGAAGAGCTTGGCGTTCCCTTTAAACCTGACACTCCTGCCCATGTTTTCAAGCGTATATAA

Retrieve as FASTA