Entry information : PblCcP02
Entry ID 5241
Creation 2007-05-16 (Marcel Zamocky)
Last sequence changes 2007-05-16 (Marcel Zamocky)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: PblCcP02
Name PblCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Mucoraceae Phycomyces
Organism Phycomyces blakesleeanus    [TaxId: 4837 ]
Cellular localisation Cytosolic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PblCcP02
start..stop
S start..stop
McirCcP01 452 2e-163 2..271 3..272
RoCcP03 448 1e-161 2..271 3..270
UramCcP01 446 9e-161 1..271 1..271
McirCcP04 346 3e-121 10..268 8..266
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 316373..316476 104 N° 2 316545..316733 189 N° 3 316835..317119 285 N° 4 317226..317463 238
join(316373..316476,316545..316733,316835..317119,317226..317463)


exon

Literature and cross-references PblCcP02
Literature unpublished, JOE genomic database
DNA ref. JGI genome:   scaffold_41 (316373..317463)
Protein sequence: PblCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   271
PWM (Da):   %s   30410.13  
PI (pH):   %s   5.95
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTENSADKYDLVRKDIIKVFPEEEYDDGSFAPVVLRLAWHASGTYDHKHKDGGSDGATMRHNTEASDPANAGLDVARNVLEPIKQKHPWISYADLWTLGGCVAIEHMGGPHIEWTGGRRDKHSDADCPPVGRLPDAALGKDHVLAVFVNRMGFTVQETVALIGAHTVGRCHRDRSGFDGPWTVTPTRFSNQFFKQLLAQTWVERKWDGPRQFEDVETQELMMLPTDIALLDEPFRKYVDIYAQDKQKFFDDFSSAFLKLIELGVAKRGKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), no EST, non-secretory.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACCGAAAACTCTGCTGATAAATACGACCTTGTTCGCAAGGATATCATCAAGGTCTTCCCCGAGGAGGAATACGACGATGGATCCTTTGCTCCCGTTGTGTAAGAAATGAACAAT
CTAGGATGATCAATAACTCACGACCCTTGTCATCGTTTTCATAACAATACAGTCTTCGTCTCGCATGGCACGCAAGTGGAACTTACGACCACAAGCACAAGGATGGAGGTAGCGATGGTG
CCACTATGCGCCACAACACTGAAGCCTCTGACCCTGCCAATGCTGGACTTGATGTCGCTAGAAACGTCCTCGAACCCATCAAGCAGAAGCATCCCTGGATTTCTTATGCTGATTTATGGA
C
GTACGTATAAGTACCAATGTTTTTCTGTTTTTCTTGAAAAAAAAATACAAATACTAGAAAAAGAGGTTTATAGCTATGTATTTATCATAAATTATCTGTAGTCTTGGTGGCTGTGTTGC
TATCGAGCACATGGGCGGTCCTCATATTGAGTGGACCGGTGGCCGTCGCGATAAGCACAGCGATGCCGATTGCCCTCCCGTCGGACGTCTTCCCGATGCTGCTCTTGGTAAAGATCATGT
CCTCGCTGTCTTTGTCAACCGTATGGGCTTTACCGTCCAAGAGACTGTCGCCCTGATCGGTGCCCACACAGTTGGCCGTTGCCATAGAGATAGATCTGGTTTCGATGGTCCCTGGACTGT
TACCCCCACCCGTTTCTCCAACCAATT
GTAAGTTTCATATCACTCCGCCAAAGAACATTTTCTGTTTTATAACACTCGTTTTCATTATTTATTTATTTTTATTTTTTTCTTAAAAAAATT
ACTCTTATCACAGTTTCAAGCAATTGCTTGCCCAGACCTGGGTTGAGAGAAAGTGGGATGGACCCAGACAGTTCGAAGATGTTGAGACTCAAGAGCTCATGATGCTCCCCACCGATATAG
CCCTCTTGGATGAGCCCTTCCGCAAATACGTTGATATTTATGCCCAGGATAAGCAGAAATTCTTTGATGACTTTTCATCTGCTTTCCTCAAATTGATCGAGTTGGGTGTCGCCAAGAGAG
GAAAGTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACCGAAAACTCTGCTGATAAATACGACCTTGTTCGCAAGGATATCATCAAGGTCTTCCCCGAGGAGGAATACGACGATGGATCCTTTGCTCCCGTTGTTCTTCGTCTCGCATGG
CACGCAAGTGGAACTTACGACCACAAGCACAAGGATGGAGGTAGCGATGGTGCCACTATGCGCCACAACACTGAAGCCTCTGACCCTGCCAATGCTGGACTTGATGTCGCTAGAAACGTC
CTCGAACCCATCAAGCAGAAGCATCCCTGGATTTCTTATGCTGATTTATGGAC
TCTTGGTGGCTGTGTTGCTATCGAGCACATGGGCGGTCCTCATATTGAGTGGACCGGTGGCCGTCGC
GATAAGCACAGCGATGCCGATTGCCCTCCCGTCGGACGTCTTCCCGATGCTGCTCTTGGTAAAGATCATGTCCTCGCTGTCTTTGTCAACCGTATGGGCTTTACCGTCCAAGAGACTGTC
GCCCTGATCGGTGCCCACACAGTTGGCCGTTGCCATAGAGATAGATCTGGTTTCGATGGTCCCTGGACTGTTACCCCCACCCGTTTCTCCAACCAATT
TTTCAAGCAATTGCTTGCCCAG
ACCTGGGTTGAGAGAAAGTGGGATGGACCCAGACAGTTCGAAGATGTTGAGACTCAAGAGCTCATGATGCTCCCCACCGATATAGCCCTCTTGGATGAGCCCTTCCGCAAATACGTTGAT
ATTTATGCCCAGGATAAGCAGAAATTCTTTGATGACTTTTCATCTGCTTTCCTCAAATTGATCGAGTTGGGTGTCGCCAAGAGAGGAAAGTTGTAA

Retrieve as FASTA