Entry information : CfulKat01 ( CAT1 / cat-1)
Entry ID 5251
Creation 2007-04-17 (Marcel Zamocky)
Last sequence changes 2016-01-27 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-27 (Christophe Dunand)
Peroxidase information: CfulKat01 ( CAT1 / cat-1)
Name (synonym) CfulKat01 ( CAT1 / cat-1)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Passalora
Organism Cladosporium fulvum    [TaxId: 5499 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CfulKat01
start..stop
S start..stop
FoKat01 902 0 1..562 1..563
GzKat04 824 0 1..565 1..538
CnKat02_grubiiH99 810 0 20..557 160..694
CnKat02_JEC21 809 0 20..557 160..694
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1653..2381 729 N° 2 2434..3405 972  
join(1653..2381,2434..3405)


exon

Literature and cross-references CfulKat01 ( CAT1 / cat-1)
Literature Bussink,H.J. and Oliver,R. Identification of two highly divergent catalase genes in the fungal tomato pathogen, Cladosporium fulvum. Eur. J. Biochem. 268 (1), 15-24 (2001)
Protein ref. GenBank:   AAG53518.1 UniProtKB:   Q9C477
DNA ref. GenBank:   AF222055.1 (827..2579)
Protein sequence: CfulKat01 ( CAT1 / cat-1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   566
PWM (Da):   %s   63742.13  
PI (pH):   %s   6.54
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPSATAHSADGRTTGDIHRDYNDDRNASAEDTVYCTSNGVPIAHPYEAQRVGDNGPLLLQDFHLVDLLSHFDRERIPERVVHAKGGGAHGYYQTTDPLDDLCLADIFQAGKKCPISVRFSTVGGESGSHDCARDPRGFSVKFRTEEGNWDMVANNTPVFFLRDPAKFPHFIHTQKRDPQSHLTHADDSTMFWDYLSQNPESVHQVMILMGDRGIPDGWRKMHGYAGHTLKLVNKKGDWVYAQMHMKSKQGTDFITQEDSANYSPDYAQKDLYQAIEKGDYPGWDVEFQTMTPKEAEDLWETQKINVFDLTHVWPQKQFPRRKVGEFFLNENVKNYFAEIEQIAFNPAHMPPGIEPSADPVLQSRLFSYPDTHRHRIGVNYQQLPVNAPRVPYRIANFQRDGAMAYLNQGSRPAYLSSIQPNQFRKRTVNLDKTHGHFVGDAVTFLSEIRPEDFNAPRALWERVWDDGARERFINNVSGHMSNCTKEEIIKRQIAIFREVSNDLATRLEKATGVEGYDGIAGLSFNGEHNGMAKDASLRAANNMVDKQSMAANNGAPAAGTHVKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Strain="Race 4".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCGTCAGCAACAGCACACTCAGCGGACGGCCGCACGACCGGCGATATCCACCGCGACTACAACGATGACAGGAATGCCTCTGCTGAGGACACTGTCTACTGCACGAGCAACGGA
GTGCCGATAGCCCATCCCTACGAGGCACAGCGAGTCGGTGACAATGGCCCTCTGCTTCTCCAAGATTTCCACTTGGTAGACCTGCTCTCCCATTTCGATCGCGAACGAATCCCAGAACGA
GTCGTTCACGCAAAGGGTGGAGGCGCCCATGGCTACTACCAGACCACCGACCCTCTGGACGACCTCTGCTTAGCAGACATCTTTCAGGCTGGCAAGAAGTGCCCCATCTCTGTCCGCTTC
TCCACAGTCGGTGGCGAGTCTGGTTCTCATGATTGCGCTCGCGATCCTCGTGGCTTCTCAGTCAAGTTCCGTACTGAGGAGGGCAACTGGGACATGGTAGCGAACAACACCCCCGTCTTC
TTCCTCCGAGATCCGGCGAAGTTCCCTCACTTCATTCACACACAGAAGCGCGACCCACAGTCGCACCTGACTCACGCCGACGATTCGACTATGTTCTGGGACTACCTGAGCCAGAATCCA
GAATCCGTTCACCAAGTCATGATTCTCATGGGTGACCGAGGTATCCCAGACGGTTGGCGTAAGATGCATGGCTATGCCGGCCACACTTTGAAGCTCGTCAACAAGAAGGGCGATTGGGTC
TATGCACAG
GTACGTTCAGATCAAACATCGTCTTTCAATGACCAGGGCTGACAATTCTTAGATGCACATGAAATCCAAGCAAGGAACCGACTTCATCACACAGGAGGACTCTGCGAACTA
TTCGCCAGATTACGCCCAGAAGGATCTATACCAGGCAATCGAAAAGGGCGATTACCCAGGCTGGGACGTTGAATTCCAGACCATGACACCAAAGGAAGCCGAGGACCTGTGGGAGACACA
GAAGATTAACGTATTCGACTTGACCCACGTCTGGCCCCAAAAGCAATTTCCCCGCCGCAAAGTCGGCGAGTTCTTCCTGAACGAAAACGTCAAGAACTACTTCGCGGAGATTGAGCAAAT
CGCCTTCAACCCCGCCCACATGCCCCCAGGCATCGAACCCTCAGCAGACCCCGTCCTCCAATCCCGCCTCTTCTCCTACCCGGACACCCACCGCCACCGCATCGGCGTCAACTACCAGCA
ACTCCCCGTCAACGCCCCCCGCGTACCCTACAGGATCGCCAACTTCCAGCGTGACGGCGCCATGGCGTACCTCAATCAGGGCTCGCGACCAGCATACCTCAGCTCCATCCAGCCCAACCA
GTTCCGGAAGCGAACTGTGAACCTCGACAAGACACACGGCCACTTCGTCGGCGACGCTGTGACGTTCTTGTCTGAGATCCGGCCTGAGGACTTCAATGCCCCTCGCGCCCTTTGGGAGCG
TGTCTGGGATGATGGTGCGCGTGAGCGTTTCATCAACAACGTCTCTGGTCACATGAGTAACTGCACGAAGGAGGAGATTATTAAGAGACAGATTGCGATTTTCCGCGAGGTGTCGAATGA
TCTCGCCACAAGGCTGGAGAAAGCTACTGGTGTGGAGGGATATGATGGTATTGCGGGGCTGAGTTTCAATGGCGAACACAATGGCATGGCGAAGGATGCTAGTCTGCGTGCTGCTAACAA
TATGGTTGATAAGCAGTCGATGGCTGCCAATAACGGTGCGCCAGCTGCTGGCACCCACGTTAAAGTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCGTCAGCAACAGCACACTCAGCGGACGGCCGCACGACCGGCGATATCCACCGCGACTACAACGATGACAGGAATGCCTCTGCTGAGGACACTGTCTACTGCACGAGCAACGGA
GTGCCGATAGCCCATCCCTACGAGGCACAGCGAGTCGGTGACAATGGCCCTCTGCTTCTCCAAGATTTCCACTTGGTAGACCTGCTCTCCCATTTCGATCGCGAACGAATCCCAGAACGA
GTCGTTCACGCAAAGGGTGGAGGCGCCCATGGCTACTACCAGACCACCGACCCTCTGGACGACCTCTGCTTAGCAGACATCTTTCAGGCTGGCAAGAAGTGCCCCATCTCTGTCCGCTTC
TCCACAGTCGGTGGCGAGTCTGGTTCTCATGATTGCGCTCGCGATCCTCGTGGCTTCTCAGTCAAGTTCCGTACTGAGGAGGGCAACTGGGACATGGTAGCGAACAACACCCCCGTCTTC
TTCCTCCGAGATCCGGCGAAGTTCCCTCACTTCATTCACACACAGAAGCGCGACCCACAGTCGCACCTGACTCACGCCGACGATTCGACTATGTTCTGGGACTACCTGAGCCAGAATCCA
GAATCCGTTCACCAAGTCATGATTCTCATGGGTGACCGAGGTATCCCAGACGGTTGGCGTAAGATGCATGGCTATGCCGGCCACACTTTGAAGCTCGTCAACAAGAAGGGCGATTGGGTC
TATGCACAG
ATGCACATGAAATCCAAGCAAGGAACCGACTTCATCACACAGGAGGACTCTGCGAACTATTCGCCAGATTACGCCCAGAAGGATCTATACCAGGCAATCGAAAAGGGCGAT
TACCCAGGCTGGGACGTTGAATTCCAGACCATGACACCAAAGGAAGCCGAGGACCTGTGGGAGACACAGAAGATTAACGTATTCGACTTGACCCACGTCTGGCCCCAAAAGCAATTTCCC
CGCCGCAAAGTCGGCGAGTTCTTCCTGAACGAAAACGTCAAGAACTACTTCGCGGAGATTGAGCAAATCGCCTTCAACCCCGCCCACATGCCCCCAGGCATCGAACCCTCAGCAGACCCC
GTCCTCCAATCCCGCCTCTTCTCCTACCCGGACACCCACCGCCACCGCATCGGCGTCAACTACCAGCAACTCCCCGTCAACGCCCCCCGCGTACCCTACAGGATCGCCAACTTCCAGCGT
GACGGCGCCATGGCGTACCTCAATCAGGGCTCGCGACCAGCATACCTCAGCTCCATCCAGCCCAACCAGTTCCGGAAGCGAACTGTGAACCTCGACAAGACACACGGCCACTTCGTCGGC
GACGCTGTGACGTTCTTGTCTGAGATCCGGCCTGAGGACTTCAATGCCCCTCGCGCCCTTTGGGAGCGTGTCTGGGATGATGGTGCGCGTGAGCGTTTCATCAACAACGTCTCTGGTCAC
ATGAGTAACTGCACGAAGGAGGAGATTATTAAGAGACAGATTGCGATTTTCCGCGAGGTGTCGAATGATCTCGCCACAAGGCTGGAGAAAGCTACTGGTGTGGAGGGATATGATGGTATT
GCGGGGCTGAGTTTCAATGGCGAACACAATGGCATGGCGAAGGATGCTAGTCTGCGTGCTGCTAACAATATGGTTGATAAGCAGTCGATGGCTGCCAATAACGGTGCGCCAGCTGCTGGC
ACCCACGTTAAAGTCAACTAA

Retrieve as FASTA