Entry information : CgKat02
Entry ID 5284
Creation 2007-04-19 (Christophe Dunand)
Last sequence changes 2007-04-19 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2012-04-24 (Catherine Mathe (Scipio))
Peroxidase information: CgKat02
Name CgKat02
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgKat02
start..stop
S start..stop
CthedisKat2 1066 0 19..704 21..722
CtheKat2 1066 0 1..704 1..722
PanKat02 1039 0 8..705 4..723
NcKat03 1033 0 4..704 2..714
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2683862..2684143 282 N° 2 2683565..2683767 203 N° 3 2683493..2683515 23 N° 4 2683228..2683406 179
N° 5 2682607..2683177 571 N° 6 2681718..2682547 830 N° 7 2681563..2681592 30  
complement(join(2681563..2681592,2681718..2682547,2682607..2683177,2683228..2683 406,2683493..2683515,2683565..2683767,2683862..2684143))


exon

Literature and cross-references CgKat02
Literature Birren,B.,et al., The Broad Institute Genome Sequencing Platform. Annotation of the Chaetomium globosum CBS 148.51 Genome
Protein ref. UniProtKB:   Q2H9X8
DNA ref. JGI genome:   scaffold_2 (2684143..2681563)
Cluster/Prediction ref. GenBank:   XM_001229491
Protein sequence: CgKat02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   705 (685)
PWM (Da):   %s   76604.72 (74512.6)  
PI (pH):   %s   5.96 (5.78) Peptide Signal:   %s   cut: 21 range:21-705
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHGRVTTLLAWGSLLGLSQAACPYAESAQLGKRDEGEALEPLAKYKIDDSSGYMSTDAGGPMEDQASLKAGARGSTLLEDFIFRQKIQHFDHERVPERAVHARGVGAHGTFTSYADWSNLTAASFLNAPDKKTPMFVRFSTVAGSRGSADLARDVHGFATRFYTDEGNDAIQFPDLVHAVKPRPDNEIPQAATAHDSAWDFFSQQPSTLHTLFWAMAGHGIPRSLRHDGFGVHTFRLVKEDGSSKLVKWHWKSRQGKASLVWEEAQIVAGKNADFHRQDLWDAIESGNGPEWELGVQIIDEDKVLAYGFDLLDPTKILPEELVPVTKLGVMKLDRNPTNYFAETEQVMFQPGHIVRGIDFTEDPLLQGRLFSYLDTQLNRNGGPNFEQLPINMPHSPIHNNNRDGAGQTFIHKNTAHYYPNTLNKGFPLQANQTVGRGFFTAPGRKISGELVRLISPTFDDHWSQPRLFYNSLSPVEQQFLINAIRFETSNVKSAEVKKNVIAQLNRVSHDVAVRVATALGLEAPAPDDTFYHNNVTAGVSTFAPNGTLPSIKTLRVGVLASTQAKDSLAQAAQLKEALAADGLVVTVVGETLAEGVDQTYSAADATGFDGVVVAEGAEALFGADSKPSPLFPAGRPGQVLIDAYRWGKPVGALGSADEALKSVGVPVDGEGVYGETAVDALVKGLEGGLARFFTDRFALDD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). Contig position: 15351-17776. Strain="CBS 148.51".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACGGCAGAGTCACAACCCTCCTTGCCTGGGGCAGTCTGTTGGGGCTGTCTCAGGCAGCATGCCCCTATGCCGAATCAGCCCAGTTGGGAAAGCGGGATGAGGGCGAGGCATTGGAG
CCTCTCGCCAAGTACAAGATAGATGACAGCAGCGGTTATATGTCCACTGATGCCGGCGGCCCCATGGAGGACCAGGCTAGCCTCAAGGCCGGCGCGAGGGGCTCCACGCTGCTCGAAGAC
TTCATCTTCCGCCAGAAGATCCAGCATTTCGATCATGAGCGT
GTAAGTACAGGGCGACACGCGATTGTTCCGCGTTTAAGATTTCTGAGACATCCACAATCACACGCCAAGACACTGACA
TGGTTCCCTCCCAAAGGTTCCCGAACGGGCGGTTCATGCTCGAGGCGTTGGAGCTCACGGCACGTTTACCAGCTATGCCGACTGGAGCAACCTCACGGCGGCATCATTTCTGAATGCTCC
GGACAAGAAGACGCCTATGTTCGTCCGCTTCTCCACCGTTGCAGGATCCAGGGGCAGCGCGGATCTCGCCAGAGACGTTCACGGGTTCGCAACCCGATT
GTAAGTCTACGCCTTTCTAGC
TAGTGTGAGCCTGGCTAACATTACTTAGCTATACTGATGAGGGCAACTTTGGTAAGCCTCTTTGGTTCTTGGCGGCTCTCACCTGCTAACCCACTTAGATATCGTTGGAAACAACATTCC
TGTTTTCTTCATCCAAGATGCCATCCAGTTCCCTGACCTGGTCCACGCCGTCAAGCCAAGGCCGGACAATGAGATCCCCCAAGCGGCCACCGCCCACGACTCTGCTTGGGACTTTTTCAG
CCAGCAGCCAAGCACTCTGCACACCCTATTCTGGGCTATGGCCGGCCATGGAATCCCGCGTAGTCTCCGTCATATG
GTAAGTGGTCTCCTCAGGTTATTTGAACAGCGTAGGGCTGATAT
CGTTAGGATGGCTTCGGCGTACACACGTTCCGTCTCGTAAAGGAGGACGGCTCGTCGAAGCTTGTCAAGTGGCACTGGAAGTCCCGTCAGGGGAAGGCCAGCCTTGTTTGGGAGGAGGCA
CAGATTGTTGCGGGCAAGAACGCCGACTTCCACCGCCAGGACCTCTGGGATGCCATCGAGTCGGGCAATGGCCCCGAGTGGGAGCTTGGCGTCCAGATTATCGACGAGGACAAGGTGCTG
GCGTACGGCTTCGACCTGTTGGACCCCACCAAGATCCTTCCCGAGGAGCTTGTGCCCGTCACGAAGCTGGGTGTGATGAAGCTGGACCGCAACCCCACGAACTACTTCGCCGAGACGGAG
CAGGTCATGTTCCAGCCCGGCCACATCGTGCGCGGCATCGACTTTACCGAAGACCCTCTGCTGCAGGGCCGTCTTTTCTCGTACCTCGACACCCAGCTGAACCGGAACGGCGGCCCCAAC
TTTGAGCAGCTGCCCATCAACATGCCGCACTCCCCCATCCACAATAACAACCGCGACGGTGCCGGCCAGACCTTCATCCACAAGAACACCGCTCATT
GTGAGTACCATCCTCTGCCCCCA
ACTCATTCCCCGCTTGTATCTAACAACCGTCCCAAGACTATCCCAACACCCTCAACAAGGGCTTCCCGCTCCAAGCCAACCAGACGGTCGGCCGTGGCTTCTTCACCGCCCCCGGTCGCA
AAATCAGCGGCGAGCTCGTGCGCCTGATCTCGCCCACCTTTGACGACCACTGGTCGCAGCCGCGGCTCTTCTACAACTCGCTCAGCCCGGTCGAGCAGCAATTCCTCATCAACGCGATCC
GCTTCGAGACGAGCAACGTCAAGTCGGCCGAGGTCAAGAAGAACGTGATCGCGCAGCTCAACCGCGTCAGCCACGACGTGGCCGTGCGCGTGGCGACGGCCCTCGGGCTCGAGGCCCCCG
CCCCCGACGACACCTTCTACCACAACAACGTCACCGCCGGCGTCTCCACCTTCGCCCCCAACGGCACCCTCCCCTCCATCAAGACCCTGCGCGTCGGCGTGCTCGCCTCCACCCAGGCCA
AGGACTCCCTCGCCCAGGCCGCCCAGCTGAAGGAGGCGCTCGCCGCCGACGGCCTGGTCGTCACTGTTGTGGGCGAGACGCTGGCGGAGGGCGTCGACCAGACGTACTCGGCGGCAGACG
CGACGGGCTTTGATGGCGTGGTTGTGGCCGAGGGCGCCGAGGCGCTGTTTGGCGCCGACAGCAAGCCCTCGCCTCTGTTCCCTGCTGGTCGGCCGGGGCAGGTGCTCATCGATGCGTACC
GCTGGGGTAAGCCGGTTGGTGCGTTGGGGTCGGCGGATGAGGCGCTGAAGAGTGTGGGCGTGCCGGTGGATGGTGAGGGTGTGTATGGTGAGACGGCGGTGGATGCGTTGGTGAAGGGGC
TTGAGGGGGGGTTGGCGAGGTTCAGA
GTGAGTTTTTCTCTTTTCTTTTCTTTTTTTCCCCCCGATTTTCTGCTGCTGCTGCTGCTGCTGTTGTTGGGATGTTGTCCTCTGGCGGCGGTAA
GGTGAAGAGTTAATGCTAACGGATTATACAGTTCACCGACCGGTTCGCGCTTGACGACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACGGCAGAGTCACAACCCTCCTTGCCTGGGGCAGTCTGTTGGGGCTGTCTCAGGCAGCATGCCCCTATGCCGAATCAGCCCAGTTGGGAAAGCGGGATGAGGGCGAGGCATTGGAG
CCTCTCGCCAAGTACAAGATAGATGACAGCAGCGGTTATATGTCCACTGATGCCGGCGGCCCCATGGAGGACCAGGCTAGCCTCAAGGCCGGCGCGAGGGGCTCCACGCTGCTCGAAGAC
TTCATCTTCCGCCAGAAGATCCAGCATTTCGATCATGAGCGT
GTTCCCGAACGGGCGGTTCATGCTCGAGGCGTTGGAGCTCACGGCACGTTTACCAGCTATGCCGACTGGAGCAACCTC
ACGGCGGCATCATTTCTGAATGCTCCGGACAAGAAGACGCCTATGTTCGTCCGCTTCTCCACCGTTGCAGGATCCAGGGGCAGCGCGGATCTCGCCAGAGACGTTCACGGGTTCGCAACC
CGATT
CTATACTGATGAGGGCAACTTTGATGCCATCCAGTTCCCTGACCTGGTCCACGCCGTCAAGCCAAGGCCGGACAATGAGATCCCCCAAGCGGCCACCGCCCACGACTCTGCTTGG
GACTTTTTCAGCCAGCAGCCAAGCACTCTGCACACCCTATTCTGGGCTATGGCCGGCCATGGAATCCCGCGTAGTCTCCGTCATATG
GATGGCTTCGGCGTACACACGTTCCGTCTCGTA
AAGGAGGACGGCTCGTCGAAGCTTGTCAAGTGGCACTGGAAGTCCCGTCAGGGGAAGGCCAGCCTTGTTTGGGAGGAGGCACAGATTGTTGCGGGCAAGAACGCCGACTTCCACCGCCAG
GACCTCTGGGATGCCATCGAGTCGGGCAATGGCCCCGAGTGGGAGCTTGGCGTCCAGATTATCGACGAGGACAAGGTGCTGGCGTACGGCTTCGACCTGTTGGACCCCACCAAGATCCTT
CCCGAGGAGCTTGTGCCCGTCACGAAGCTGGGTGTGATGAAGCTGGACCGCAACCCCACGAACTACTTCGCCGAGACGGAGCAGGTCATGTTCCAGCCCGGCCACATCGTGCGCGGCATC
GACTTTACCGAAGACCCTCTGCTGCAGGGCCGTCTTTTCTCGTACCTCGACACCCAGCTGAACCGGAACGGCGGCCCCAACTTTGAGCAGCTGCCCATCAACATGCCGCACTCCCCCATC
CACAATAACAACCGCGACGGTGCCGGCCAGACCTTCATCCACAAGAACACCGCTCATT
ACTATCCCAACACCCTCAACAAGGGCTTCCCGCTCCAAGCCAACCAGACGGTCGGCCGTGGC
TTCTTCACCGCCCCCGGTCGCAAAATCAGCGGCGAGCTCGTGCGCCTGATCTCGCCCACCTTTGACGACCACTGGTCGCAGCCGCGGCTCTTCTACAACTCGCTCAGCCCGGTCGAGCAG
CAATTCCTCATCAACGCGATCCGCTTCGAGACGAGCAACGTCAAGTCGGCCGAGGTCAAGAAGAACGTGATCGCGCAGCTCAACCGCGTCAGCCACGACGTGGCCGTGCGCGTGGCGACG
GCCCTCGGGCTCGAGGCCCCCGCCCCCGACGACACCTTCTACCACAACAACGTCACCGCCGGCGTCTCCACCTTCGCCCCCAACGGCACCCTCCCCTCCATCAAGACCCTGCGCGTCGGC
GTGCTCGCCTCCACCCAGGCCAAGGACTCCCTCGCCCAGGCCGCCCAGCTGAAGGAGGCGCTCGCCGCCGACGGCCTGGTCGTCACTGTTGTGGGCGAGACGCTGGCGGAGGGCGTCGAC
CAGACGTACTCGGCGGCAGACGCGACGGGCTTTGATGGCGTGGTTGTGGCCGAGGGCGCCGAGGCGCTGTTTGGCGCCGACAGCAAGCCCTCGCCTCTGTTCCCTGCTGGTCGGCCGGGG
CAGGTGCTCATCGATGCGTACCGCTGGGGTAAGCCGGTTGGTGCGTTGGGGTCGGCGGATGAGGCGCTGAAGAGTGTGGGCGTGCCGGTGGATGGTGAGGGTGTGTATGGTGAGACGGCG
GTGGATGCGTTGGTGAAGGGGCTTGAGGGGGGGTTGGCGAGGTTCAGA
TTCACCGACCGGTTCGCGCTTGACGACTAG

Retrieve as FASTA