Entry information : GmPrx[P]249
Entry ID 533
Creation 2006-01-18 (Christophe Dunand)
Last sequence changes 2012-05-07 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Christophe Dunand)
Peroxidase information: GmPrx[P]249
Name GmPrx[P]249
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]249
start..stop
S start..stop
GmPrx249 301 1e-104 1..178 137..311
GmPrx74 293 2e-101 1..178 137..312
GmPrx[P]227 263 1e-90 1..178 63..237
GmPrx330 257 4e-87 1..178 138..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 31798423..31798588 166 N° 2 31798743..31799110 368  
join(31798423..31798588,31798743..31799110)


exon

Literature and cross-references GmPrx[P]249
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm03 (31798423..31799106)
Protein sequence: GmPrx[P]249
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   176
PWM (Da):   %s   18342.97  
PI (pH):   %s   7.6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LGGPSWNVGLSKRDSTTASKDSATTDIPSLLMDLSALISAFSNKGFNTKEMVSLSGAHTTRQARYQLFRGRVYNESNIESNFATSLKSNCPSTGGDNNLSPLDVTTSALFGTAYFKNLINxKGHVHSD*QLFSDGSTDSQITLxYSNDPSA*xFYADFSSAMVKMGNLSPLTGKSGLI

Retrieve as FASTA  
Remarks Pseudogene from genomic (stop codon in frame, exons 1 and 2 are missing which can't be found). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGGGAGGTCCATCATGGAATGTTGGGTTAAGCAAAAGAGATTCAACCACGGCAAGTAAAGATTCTGCCACTACGGATATCCCATCCCTACTAATGGATCTTAGTGCCCTTATATCTGCT
TTTTCAAATAAGGGGTTTAACACCAAGGAAATGGTATCCCTCTCAG
GTAAATATTAGAGGATCTCTCATATTACTCACTAAGACTTTAACTTATTAATTAATGGCATTAATATAAGTAAG
ATTATATATTATGTCAACAATATATATTATCACACATATATGAATCTTGTGTCATCTAATAATTTTTCATGCATAAATAGGAGCTCATACCACGAGGCAAGCCAGGTATCAGCTATTCAG
AGGCAGGGTTTACAATGAAAGCAACATTGAGTCAAACTTTGCAACATCACTCAAGTCAAACTGTCCAAGCACTGGTGGAGACAACAACCTTTCCCCACTTGATGTCACCACAAGTGCTCT
ATTTGGCACTGCTTATTTCAAGAATCTCATCAACAANAAAGGGCATGTACATTCTGATTAGCAGTTATTTAGTGATGGTTCTACAGATTCTCAGATCACACTACCNTATAGCAATGACCC
TTCAGCTTAATNNTTCTATGCAGACTTTTCTAGTGCCATGGTCAAAATGGGAAACCTTAGCCCCTTAACAGGGAAAAGTGGCTTAATC

Retrieve as FASTA