Entry information : FoCP01
Entry ID 5353
Creation 2007-05-15 (Marcel Zamocky)
Last sequence changes 2011-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: FoCP01
Name FoCP01
Class Catalase peroxidase    [Orthogroup: CP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Fusarium
Organism Fusarium oxysporum    [TaxId: 5507 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FoCP01
start..stop
S start..stop
GmoCP01 1598 0 1..801 1..800
GzCP01 1415 0 1..801 1..801
NhaeCP01 1270 0 44..801 3..760
TatCP01 1130 0 41..801 1..761
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1001348..1001803 456 N° 2 1000892..1001288 397 N° 3 999286..1000838 1553  
complement(join(999286..1000838,1000892..1001288,1001348..1001803))


exon

Literature and cross-references FoCP01
Literature Broad Institute genome project, unpublished
DNA ref. JGI genome:   Supercontig_2.16 (1001803..999286)
EST ref. GenBank:   EC593125 [3' end]
Protein sequence: FoCP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   801
PWM (Da):   %s   88400.44  
PI (pH):   %s   6.95
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPRFLFPSSRILSLSVARRTLNLNLNQQTTRLSLHTSAPKMADERKCPVAHKVPNVAGHGVTHQKWWPEALKTNILRQHSAVTNPYGENFNYAEAFNSIDYNELKEDLRKVCRDSQDWWPADFGHYGGLFVRMSWHAVGTYRVFDGRGGGRQGQQRFAPLNSWPDNVSLDKARRLLWPVKQKYGNKVSWADLIVMAGNVALEDMGFKTIGFAAGRPDTWEADEATYYGGEDTWLGNDVRYSDGHPGTTKPGATDSDQPPHKNIHTRELEKPLAAAHHGLIYVNPEGPDGNPDPVAAARDIRETFGRMAMNDEETVALIAGGHTVGKTHGAGSTDHVGPEPEAADLAQQGLGWSNSYKTGKGPHTTTSGLEVTWTSTPVKWSHDYLKYLFQFEWELTKSPAGAHQWVAKDANATVPDAFDPNKKQKPTMLTTDLSLRFDPEYEKISRRFLENPDQFNEAFAKAWFKLTHRDMGPRDRYLGPEVPKEVFLWQDPVPERDYKLADDGDISAIKNEILKSGIDVSKLVSTAWASASTFRGSDLRGGANGARIRLQPQKDWEVNNPAQLSKVLSTLEGIQKKFNDSQSSGKAISLADVIVLAGSAAVEKAAKDAGVNITVPFAPGRTDATQEQTDVKSVNHLQPFADGFRNYGSSTDRVKLEHQLIDRAQLLTLSVPELTALIGGLRALNTNYDGSSHGIFTNRPGVLTNDFFVNLLDMSTEWKAVGNSDIFEGTDRKTGAKKWTGTRVDLVFGSHAELRATAETYAEAGGQEKLVKDFVAAWTKVMNLDRFDLANGSSPKASPRL

Retrieve as FASTA  
Remarks Complete from genomic (Chromo 13, 2 introns) and 1 EST. Strain="4286".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCGGTTTCTCTTCCCTTCCTCTCGTATTCTGTCCTTGTCTGTTGCGAGGAGGACTCTGAATCTGAATCTGAACCAACAAACCACCAGATTATCGCTTCACACCTCAGCTCCAAAA
ATGGCCGACGAGAGAAAGTGTCCCGTGGCCCACAAGGTCCCCAACGTCGCTGGTCACGGCGTTACCCATCAGAAGTGGTGGCCCGAGGCTCTCAAGACCAACATTCTTCGTCAGCATAGC
GCCGTCACCAACCCCTACGGCGAGAACTTCAACTACGCCGAGGCTTTCAACTCTATTGACTACAACGAGCTTAAGGAGGATCTGCGAAAGGTCTGCCGCGATTCGCAGGACTGGTGGCCT
GCTGATTTCGGCCACTATGGTGGTCTCTTTGTCCGTATGTCGTGGCACGCCGTTGGAACATACCGTGTCTTCGATGGCCGAGGTGGCGGCCGACAG
GTAAGAAACCCATTACACCCTCTC
TCTCTCAATCGCGCACAAGTCTAACAGCGTCATAGGGTCAGCAAAGATTCGCCCCCCTCAACTCTTGGCCCGATAACGTTTCCCTCGACAAGGCCCGCCGTCTTCTGTGGCCCGTCAAGC
AAAAGTACGGCAACAAGGTCTCATGGGCCGACCTGATCGTCATGGCTGGCAACGTCGCCCTCGAGGATATGGGCTTCAAGACCATTGGTTTCGCCGCTGGTCGTCCGGATACTTGGGAGG
CTGACGAGGCTACCTACTACGGTGGCGAGGATACTTGGCTCGGAAACGACGTCCGTTACTCTGATGGCCACCCCGGAACCACCAAGCCTGGCGCTACCGATTCCGATCAGCCTCCCCACA
AGAACATTCACACCCGCGAGCTTGAGAAGCCTCTGGCTGCTGCTCACCACGGTCTTATTTATGTTAACCCTG
GTCAGTCCTCCCCCGAGACAATGCGTAATGCACAATCACTGACTTTAT
CGCAGAGGGTCCTGATGGCAACCCCGACCCCGTCGCCGCTGCCCGTGACATCCGCGAGACCTTCGGTCGCATGGCCATGAACGACGAGGAGACCGTCGCCCTCATCGCCGGTGGTCATAC
CGTCGGAAAGACTCACGGCGCTGGCTCAACCGACCACGTCGGCCCCGAGCCCGAGGCCGCTGATCTCGCCCAGCAGGGTCTCGGCTGGTCCAACAGCTACAAGACCGGCAAGGGTCCTCA
CACAACCACCTCCGGCCTCGAGGTTACCTGGACCAGCACTCCCGTCAAGTGGAGCCACGACTACCTCAAGTACCTCTTCCAGTTCGAATGGGAGCTCACAAAGAGCCCTGCTGGCGCTCA
CCAGTGGGTTGCCAAGGATGCCAACGCCACTGTTCCTGATGCCTTCGACCCCAACAAGAAACAGAAGCCTACCATGTTGACCACCGATTTGTCTCTGCGATTCGACCCTGAGTACGAGAA
GATCTCCCGTCGCTTCCTCGAGAACCCAGATCAGTTCAACGAGGCTTTCGCCAAGGCCTGGTTCAAGCTTACCCACCGTGACATGGGTCCCCGCGACCGATACCTCGGCCCTGAGGTCCC
CAAGGAGGTCTTCCTCTGGCAAGACCCCGTTCCCGAGCGTGACTACAAGCTCGCCGACGATGGCGATATTTCCGCCATCAAGAACGAGATCCTCAAGTCTGGTATTGACGTCTCCAAGCT
CGTCTCTACCGCTTGGGCCTCCGCCTCCACCTTCCGAGGCAGTGATCTCCGCGGTGGTGCCAATGGCGCCCGTATCCGCCTTCAGCCGCAGAAGGACTGGGAGGTCAACAACCCCGCTCA
ATTGAGCAAGGTCCTCAGCACTCTTGAGGGCATCCAGAAGAAGTTCAACGACTCTCAGTCCAGCGGCAAGGCCATCTCCCTTGCTGATGTTATTGTTCTTGCTGGTTCCGCCGCCGTGGA
GAAGGCTGCTAAGGATGCCGGTGTTAACATCACCGTGCCCTTCGCGCCCGGCCGCACCGACGCTACACAGGAGCAGACCGACGTCAAGTCCGTCAACCACCTTCAGCCTTTCGCCGATGG
CTTCCGTAACTACGGCTCTTCTACAGACCGCGTCAAGCTTGAGCACCAGCTCATTGACCGCGCTCAACTCCTCACCCTCAGCGTCCCTGAGCTCACCGCTCTCATCGGTGGTCTCCGTGC
CCTCAACACCAACTATGACGGCTCATCGCATGGTATCTTCACTAACCGTCCTGGTGTTCTGACCAACGACTTCTTCGTCAACCTGCTCGACATGAGCACTGAGTGGAAGGCCGTTGGAAA
CAGTGATATCTTCGAGGGTACTGATCGCAAGACTGGTGCCAAGAAGTGGACCGGTACTCGTGTCGATCTTGTCTTTGGTTCACATGCTGAGCTCCGCGCTACAGCTGAGACATATGCTGA
GGCTGGTGGACAGGAGAAGCTTGTCAAGGACTTTGTTGCTGCTTGGACCAAGGTGATGAACCTGGACCGATTTGATCTTGCGAACGGTTCTTCACCCAAGGCCTCTCCTCGACTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCGGTTTCTCTTCCCTTCCTCTCGTATTCTGTCCTTGTCTGTTGCGAGGAGGACTCTGAATCTGAATCTGAACCAACAAACCACCAGATTATCGCTTCACACCTCAGCTCCAAAA
ATGGCCGACGAGAGAAAGTGTCCCGTGGCCCACAAGGTCCCCAACGTCGCTGGTCACGGCGTTACCCATCAGAAGTGGTGGCCCGAGGCTCTCAAGACCAACATTCTTCGTCAGCATAGC
GCCGTCACCAACCCCTACGGCGAGAACTTCAACTACGCCGAGGCTTTCAACTCTATTGACTACAACGAGCTTAAGGAGGATCTGCGAAAGGTCTGCCGCGATTCGCAGGACTGGTGGCCT
GCTGATTTCGGCCACTATGGTGGTCTCTTTGTCCGTATGTCGTGGCACGCCGTTGGAACATACCGTGTCTTCGATGGCCGAGGTGGCGGCCGACAG
GGTCAGCAAAGATTCGCCCCCCTC
AACTCTTGGCCCGATAACGTTTCCCTCGACAAGGCCCGCCGTCTTCTGTGGCCCGTCAAGCAAAAGTACGGCAACAAGGTCTCATGGGCCGACCTGATCGTCATGGCTGGCAACGTCGCC
CTCGAGGATATGGGCTTCAAGACCATTGGTTTCGCCGCTGGTCGTCCGGATACTTGGGAGGCTGACGAGGCTACCTACTACGGTGGCGAGGATACTTGGCTCGGAAACGACGTCCGTTAC
TCTGATGGCCACCCCGGAACCACCAAGCCTGGCGCTACCGATTCCGATCAGCCTCCCCACAAGAACATTCACACCCGCGAGCTTGAGAAGCCTCTGGCTGCTGCTCACCACGGTCTTATT
TATGTTAACCCTG
AGGGTCCTGATGGCAACCCCGACCCCGTCGCCGCTGCCCGTGACATCCGCGAGACCTTCGGTCGCATGGCCATGAACGACGAGGAGACCGTCGCCCTCATCGCCGGT
GGTCATACCGTCGGAAAGACTCACGGCGCTGGCTCAACCGACCACGTCGGCCCCGAGCCCGAGGCCGCTGATCTCGCCCAGCAGGGTCTCGGCTGGTCCAACAGCTACAAGACCGGCAAG
GGTCCTCACACAACCACCTCCGGCCTCGAGGTTACCTGGACCAGCACTCCCGTCAAGTGGAGCCACGACTACCTCAAGTACCTCTTCCAGTTCGAATGGGAGCTCACAAAGAGCCCTGCT
GGCGCTCACCAGTGGGTTGCCAAGGATGCCAACGCCACTGTTCCTGATGCCTTCGACCCCAACAAGAAACAGAAGCCTACCATGTTGACCACCGATTTGTCTCTGCGATTCGACCCTGAG
TACGAGAAGATCTCCCGTCGCTTCCTCGAGAACCCAGATCAGTTCAACGAGGCTTTCGCCAAGGCCTGGTTCAAGCTTACCCACCGTGACATGGGTCCCCGCGACCGATACCTCGGCCCT
GAGGTCCCCAAGGAGGTCTTCCTCTGGCAAGACCCCGTTCCCGAGCGTGACTACAAGCTCGCCGACGATGGCGATATTTCCGCCATCAAGAACGAGATCCTCAAGTCTGGTATTGACGTC
TCCAAGCTCGTCTCTACCGCTTGGGCCTCCGCCTCCACCTTCCGAGGCAGTGATCTCCGCGGTGGTGCCAATGGCGCCCGTATCCGCCTTCAGCCGCAGAAGGACTGGGAGGTCAACAAC
CCCGCTCAATTGAGCAAGGTCCTCAGCACTCTTGAGGGCATCCAGAAGAAGTTCAACGACTCTCAGTCCAGCGGCAAGGCCATCTCCCTTGCTGATGTTATTGTTCTTGCTGGTTCCGCC
GCCGTGGAGAAGGCTGCTAAGGATGCCGGTGTTAACATCACCGTGCCCTTCGCGCCCGGCCGCACCGACGCTACACAGGAGCAGACCGACGTCAAGTCCGTCAACCACCTTCAGCCTTTC
GCCGATGGCTTCCGTAACTACGGCTCTTCTACAGACCGCGTCAAGCTTGAGCACCAGCTCATTGACCGCGCTCAACTCCTCACCCTCAGCGTCCCTGAGCTCACCGCTCTCATCGGTGGT
CTCCGTGCCCTCAACACCAACTATGACGGCTCATCGCATGGTATCTTCACTAACCGTCCTGGTGTTCTGACCAACGACTTCTTCGTCAACCTGCTCGACATGAGCACTGAGTGGAAGGCC
GTTGGAAACAGTGATATCTTCGAGGGTACTGATCGCAAGACTGGTGCCAAGAAGTGGACCGGTACTCGTGTCGATCTTGTCTTTGGTTCACATGCTGAGCTCCGCGCTACAGCTGAGACA
TATGCTGAGGCTGGTGGACAGGAGAAGCTTGTCAAGGACTTTGTTGCTGCTTGGACCAAGGTGATGAACCTGGACCGATTTGATCTTGCGAACGGTTCTTCACCCAAGGCCTCTCCTCGA
CTGTAA

Retrieve as FASTA