Entry information : GmPrx45 (Glyma12g10850.1)
Entry ID 536
Creation 2008-12-30 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx45 (Glyma12g10850.1)
Name (synonym) GmPrx45 (Glyma12g10850.1)
Class Class III peroxidase    [Orthogroup: Prx121]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Roots of 'Supernod' plants
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx45
start..stop
S start..stop
GmPrx10 632 0 1..324 1..324
PvPrx12 583 0 1..324 1..325
GmPrx162 565 0 1..324 1..325
MtPrx53 540 0 1..323 3..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8880784..8880993 210 N° 2 8881091..8881282 192 N° 3 8881721..8881883 163 N° 4 8882484..8882893 410
join(8880784..8880993,8881091..8881282,8881721..8881883,8882484..8882893)


exon

Literature and cross-references GmPrx45 (Glyma12g10850.1)
Literature Moskal,W., Xiao,Y. and Town,C.D. Construction and analysis of normalized cDNA library from root tissues of Glycine max.
DNA ref. Phytozome 12:   Gm12 (8880784..8882893)
EST ref. GenBank:   EV280160 [5' end]   EV279186 [3' end]
Cluster/Prediction ref. UniGene:   Gma.36309
Protein sequence: GmPrx45 (Glyma12g10850.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (301)
PWM (Da):   %s   35414.23 (32951.0)  
PI (pH):   %s   8.1 (8.01) Peptide Signal:   %s   cut: 24 range:24-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSQSCFKALIICLIALIGSTQAQLQLGFYAKSCPKAEKIILKYVVEHIRNAPSLAAALIRMHFHDCFVNGCDGSVLVDSTPGNQAEKDSIPNLTLRGFGFIDAIKRLVEAECPGVVSCADILALTARDSIHATGGPYWNVPTGRRDGLISRAADPLRSLPAPFHNLTTQLTLFGNVGLDANDLVLLVGAHTIGVAHCSSIATRLYNFTGKGDIDPTLDSEYAKNIKTFKCKNINDNTIIEMDPGSRDTFDLGFYKQVVKRRGLFQSDAEFLTSPITRSIIDRQLQSTQGFFEEFAKSIEKMGRINVKLGTEGEIRKHCARVNN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 5 ESTs. Cultivar="Williams 82".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAGCCAGAGTTGCTTCAAGGCTTTGATTATTTGCCTTATAGCATTAATTGGATCAACTCAAGCTCAATTGCAGCTTGGTTTCTATGCCAAAAGTTGTCCAAAGGCCGAGAAAATA
ATTTTGAAGTATGTTGTAGAGCATATCCGCAATGCTCCATCACTAGCAGCTGCTCTCATAAGAATGCACTTCCATGATTGTTTTGTCAAT
GTATGCACATAATTATGTTGTTTTTTTCTT
TTATTATACTGTGGAGATAATTAACTATGTAACATTAACATGTAGTACATATTAATATAAATTTCAGGGTTGTGATGGATCAGTGCTTGTGGACTCAACACCAGGCAATCAAGCTGAAAA
GGACTCTATTCCAAATCTTACACTCCGAGGCTTTGGTTTCATTGACGCAATAAAGAGGCTTGTTGAAGCTGAATGCCCTGGGGTAGTCTCTTGTGCTGATATCTTGGCCTTGACCGCCAG
AGACTCTATTCATGCCACT
GTAAGTACTCACTCTTGTTTCACCCTCATCTCTAAGGAAACATGAATACTTTGAATAATAGTTAAGCTGCATCCTATTAGAGTGGAAAATTCATATTGCAT
TTACTTGTATTGAAAATGTATCTATACAGTTCACAAATGCTTTGAATCTCCCAAACCCTTCATTTTTTTTTGTGATTTCTATCTGTTTTCATCACAAAACGCTTGCATGGCTCAATCAGA
CATTATATTGTCATGCTTGTGTTACTCACTAGGGTTGGCCTAGGGGTAAAAATTATGGTAAATGCATGAAAATTTAAGTTGGATTTTTATTATTGTCGTTCTAAAAAGAAGAAGAAAAAA
AACTCATGTTTGTGTTATGTTTTCTCTAGGCTTTGTTACATAGGGTAGAAATTAAATGACATCTTCTTGTGTTGCCATGATTGACATGGGTTTGCAGGGTGGACCCTATTGGAATGTTCC
AACAGGACGAAGGGATGGGCTCATCTCTAGAGCAGCAGATCCGTTACGCAGCCTGCCTGCTCCATTTCACAACCTCACTACCCAACTAACACTCTTTGGCAATGTTGGACTTGATGCAAA
CGACCTTGTCTTGCTTGTTG
GTATGTCAAACACTAAGTTGCATGATAAAAGTTTGCATCAGGGTTGTTTAGAAATTTTTTTCCACTTTTAATTATAAAATTGGCACTACATTTTTTACTT
ATTTTTTTATTTCTGAAATATGTACTTGTTCCGTATTTAAATATAAGAAAAAAACACTCTTGAATTAATTAAATGTGAGTAACATCTCCGATAAATATGATTAATGGTAGTTTAGAAAAT
GTTATCTTTTTATAAATAAAATCAAGAAAAATATATAAACTTAACTAACAATTAGTGTGAAATCATATGTTTTTGTTTATATTTGAGTTTGTAAAAAGTATAAGAACGCATAAAACGTAA
AAGAAAGTTGTTTTCATCATTTTAGTACAATATTTAAAAACAAAAAAAATGAGGTGACAATTTGTACCAATTTTAAAATAAAAAATGAAAACAAAATAATGTTTCTCAAAGTAAATAAGT
CCTAAGTCAATGAAATGAAACTCTAATTATGATTGAAAAATAATACCAGAAACACCAAATAATTATATCTAAGTTTTTTCCTTTTTTATGTTCTACATTTTAAACTTTGTCTCTAATTAT
AAAAAATTCTATTCTTTCAGGTGCTCACACAATTGGTGTTGCCCATTGTTCATCAATTGCAACTCGTCTATACAATTTCACTGGCAAGGGTGACATAGACCCAACACTAGACAGTGAATA
TGCAAAAAATATCAAAACTTTTAAGTGTAAGAACATCAATGATAATACAATTATTGAGATGGATCCTGGAAGTCGCGATACATTTGATCTTGGATTTTATAAACAAGTTGTTAAGAGAAG
GGGCTTGTTTCAGTCAGATGCTGAATTTCTTACTAGTCCTATCACAAGGTCTATTATCGATAGACAACTTCAATCAACTCAAGGATTCTTTGAGGAATTTGCCAAGTCTATCGAGAAAAT
GGGACGAATTAATGTCAAGCTTGGAACTGAAGGGGAGATAAGGAAACATTGTGCACGAGTTAATAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAGCCAGAGTTGCTTCAAGGCTTTGATTATTTGCCTTATAGCATTAATTGGATCAACTCAAGCTCAATTGCAGCTTGGTTTCTATGCCAAAAGTTGTCCAAAGGCCGAGAAAATA
ATTTTGAAGTATGTTGTAGAGCATATCCGCAATGCTCCATCACTAGCAGCTGCTCTCATAAGAATGCACTTCCATGATTGTTTTGTCAAT
GGTTGTGATGGATCAGTGCTTGTGGACTCA
ACACCAGGCAATCAAGCTGAAAAGGACTCTATTCCAAATCTTACACTCCGAGGCTTTGGTTTCATTGACGCAATAAAGAGGCTTGTTGAAGCTGAATGCCCTGGGGTAGTCTCTTGTGCT
GATATCTTGGCCTTGACCGCCAGAGACTCTATTCATGCCACT
GGTGGACCCTATTGGAATGTTCCAACAGGACGAAGGGATGGGCTCATCTCTAGAGCAGCAGATCCGTTACGCAGCCTG
CCTGCTCCATTTCACAACCTCACTACCCAACTAACACTCTTTGGCAATGTTGGACTTGATGCAAACGACCTTGTCTTGCTTGTTG
GTGCTCACACAATTGGTGTTGCCCATTGTTCATCA
ATTGCAACTCGTCTATACAATTTCACTGGCAAGGGTGACATAGACCCAACACTAGACAGTGAATATGCAAAAAATATCAAAACTTTTAAGTGTAAGAACATCAATGATAATACAATTATT
GAGATGGATCCTGGAAGTCGCGATACATTTGATCTTGGATTTTATAAACAAGTTGTTAAGAGAAGGGGCTTGTTTCAGTCAGATGCTGAATTTCTTACTAGTCCTATCACAAGGTCTATT
ATCGATAGACAACTTCAATCAACTCAAGGATTCTTTGAGGAATTTGCCAAGTCTATCGAGAAAATGGGACGAATTAATGTCAAGCTTGGAACTGAAGGGGAGATAAGGAAACATTGTGCA
CGAGTTAATAACTAA

Retrieve as FASTA