Entry information : GzAPx-CcP01
Entry ID 5363
Creation 2007-05-16 (Marcel Zamocky)
Last sequence changes 2007-05-16 (Marcel Zamocky)
Sequence status complete
Reviewer Laure Collomb
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: GzAPx-CcP01
Name GzAPx-CcP01
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella zeae (anamorph Fusarium graminearum)    [TaxId: 5518 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GzAPx-CcP01
start..stop
S start..stop
FpsAPx-CcP1 1024 0 1..530 1..530
GmoAPx-CcP01 768 0 1..526 1..526
FoAPx-CcP01 763 0 1..526 1..526
CgloAPx-CcP03_Naragc5 517 1e-180 1..530 1..538
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 775899..776037 139 N° 2 774392..775848 1457  
complement(join(774392..775848,775899..776037))


exon

Literature and cross-references GzAPx-CcP01
Literature unpublished, Broad Institute
DNA ref. JGI genome:   Supercontig_3.2 (776037..774392)
Protein sequence: GzAPx-CcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   531 (514)
PWM (Da):   %s   56979.76 (55388.9)  
PI (pH):   %s   9.3 (9.16) Peptide Signal:   %s   cut: 18 range:18-531
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKGPSTVAIALVPLAAAKQLVWPSKFDYLEDLQYNQGGYNKFGFADALITCTFGNSQPGRQNSAEWIRTAFHDAVTHDAKAGTGGLDASIFWETTRAENPGKAWNNTFGFFDGFYNQRASAADLIALGTVVATGGCSGPNVPFRAGRIDAGKPGPSGVPEPSTNLKETFAAFQKAGFTKEDMTAMVACGHALGGVHSVDFPDVTGIKADPNNDTSVPFQKDISSFHNGVVTEYLDGTTKNPLVVAKNNTLNSDKRIFDNDRATMKKLSTKQGFNTMCADIFARMIDTVPKSVQLSDVISPYDVKPYVTELSLNSKGKIVFKGSVRLMTTNNIRDGDDLIVSLTYMGHDGKKTVVPTTKAMWQSGSSFGSGQLFVNFEFDTTIDAKNGITKFWIKETKKSTKVSKSHDNQGTHGYKVDDTVLYQISDSCLAADQLPSAPMTITAVVRDSQAKNALTLKAVDRVSQKGTVVPKLQTKVVPFKATGKKVNGYTTFKAQTKINDDNIRFDIALAGNAAAGVQFQAALAVPHGSCK

Retrieve as FASTA  
Remarks Complete from genomic (1 intron). No EST available. Contig position: 51915-50273. Strain="PH-1.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGGCCCTTCCACTGTCGCTATTGCTCTCGTTCCCCTCGCAGCTGCCAAGCAACTTGTCTGGCCCTCAAAGTTCGATTATCTTGAGGATCTCCAGTACAACCAGGGTGGATACAAC
AAGTTTGGTTTCGCTGATG
GTAAGTTACTTTCAACAGTCTTTACTTGACATCATACTAACAACTCACAGCTCTGATTACTTGCACCTTTGGCAACAGCCAGCCTGGACGACAAAACTCGG
CCGAATGGATCCGAACAGCTTTCCACGACGCCGTCACACACGATGCCAAGGCTGGCACTGGAGGTCTTGACGCTTCCATCTTCTGGGAGACCACCCGTGCTGAGAACCCCGGTAAAGCTT
GGAACAACACTTTCGGCTTTTTCGACGGCTTCTACAACCAGCGTGCCAGTGCTGCTGATCTCATCGCCCTCGGCACTGTTGTTGCCACCGGAGGATGTTCCGGCCCTAACGTCCCATTCC
GAGCTGGCCGTATCGATGCCGGCAAGCCTGGACCCTCCGGTGTCCCTGAGCCCTCCACCAACCTCAAGGAGACCTTTGCCGCTTTCCAAAAGGCTGGCTTCACCAAGGAGGACATGACCG
CCATGGTTGCTTGTGGCCACGCCCTCGGTGGTGTTCACAGCGTTGACTTCCCTGATGTCACTGGCATCAAGGCCGACCCCAACAACGACACATCCGTTCCTTTCCAGAAGGACATCTCCA
GCTTCCACAACGGTGTCGTCACCGAGTACCTCGATGGAACTACCAAGAACCCTCTCGTTGTTGCCAAGAACAACACACTCAACTCCGACAAGCGTATCTTCGACAACGACCGTGCTACCA
TGAAGAAGCTCTCCACCAAGCAGGGCTTCAACACCATGTGTGCCGATATCTTTGCTCGCATGATCGACACTGTCCCCAAGAGCGTGCAGCTCAGCGATGTCATCTCCCCCTACGACGTCA
AGCCTTATGTTACTGAGCTTTCCCTCAACAGCAAGGGCAAGATCGTCTTCAAGGGTTCCGTCCGCCTCATGACCACCAATAATATCCGAGATGGTGATGATCTTATCGTCTCGCTTACCT
ACATGGGCCACGACGGCAAGAAGACCGTCGTCCCCACCACCAAGGCCATGTGGCAGTCAGGTTCCTCTTTCGGCTCTGGCCAGTTGTTTGTCAACTTTGAGTTCGACACCACCATTGACG
CCAAGAACGGTATCACCAAGTTCTGGATCAAGGAGACCAAGAAGTCTACCAAGGTCAGCAAGTCTCACGACAACCAGGGCACCCACGGTTACAAGGTCGACGACACCGTCCTCTACCAGA
TCTCCGACTCCTGCCTTGCCGCCGACCAGCTGCCCAGCGCTCCCATGACTATCACCGCCGTTGTCCGTGACAGCCAGGCCAAGAACGCCCTGACCCTCAAGGCTGTTGACAGGGTTTCCC
AGAAGGGAACTGTTGTTCCCAAGCTCCAGACTAAGGTTGTCCCCTTCAAGGCCACTGGCAAGAAGGTCAACGGTTACACCACCTTCAAGGCCCAGACCAAGATCAACGACGACAACATCC
GGTTCGACATTGCTCTTGCCGGAAACGCTGCTGCTGGCGTGCAGTTCCAGGCAGCTCTTGCTGTTCCCCATGGCTCTTGCAAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGGCCCTTCCACTGTCGCTATTGCTCTCGTTCCCCTCGCAGCTGCCAAGCAACTTGTCTGGCCCTCAAAGTTCGATTATCTTGAGGATCTCCAGTACAACCAGGGTGGATACAAC
AAGTTTGGTTTCGCTGATG
CTCTGATTACTTGCACCTTTGGCAACAGCCAGCCTGGACGACAAAACTCGGCCGAATGGATCCGAACAGCTTTCCACGACGCCGTCACACACGATGCCAAG
GCTGGCACTGGAGGTCTTGACGCTTCCATCTTCTGGGAGACCACCCGTGCTGAGAACCCCGGTAAAGCTTGGAACAACACTTTCGGCTTTTTCGACGGCTTCTACAACCAGCGTGCCAGT
GCTGCTGATCTCATCGCCCTCGGCACTGTTGTTGCCACCGGAGGATGTTCCGGCCCTAACGTCCCATTCCGAGCTGGCCGTATCGATGCCGGCAAGCCTGGACCCTCCGGTGTCCCTGAG
CCCTCCACCAACCTCAAGGAGACCTTTGCCGCTTTCCAAAAGGCTGGCTTCACCAAGGAGGACATGACCGCCATGGTTGCTTGTGGCCACGCCCTCGGTGGTGTTCACAGCGTTGACTTC
CCTGATGTCACTGGCATCAAGGCCGACCCCAACAACGACACATCCGTTCCTTTCCAGAAGGACATCTCCAGCTTCCACAACGGTGTCGTCACCGAGTACCTCGATGGAACTACCAAGAAC
CCTCTCGTTGTTGCCAAGAACAACACACTCAACTCCGACAAGCGTATCTTCGACAACGACCGTGCTACCATGAAGAAGCTCTCCACCAAGCAGGGCTTCAACACCATGTGTGCCGATATC
TTTGCTCGCATGATCGACACTGTCCCCAAGAGCGTGCAGCTCAGCGATGTCATCTCCCCCTACGACGTCAAGCCTTATGTTACTGAGCTTTCCCTCAACAGCAAGGGCAAGATCGTCTTC
AAGGGTTCCGTCCGCCTCATGACCACCAATAATATCCGAGATGGTGATGATCTTATCGTCTCGCTTACCTACATGGGCCACGACGGCAAGAAGACCGTCGTCCCCACCACCAAGGCCATG
TGGCAGTCAGGTTCCTCTTTCGGCTCTGGCCAGTTGTTTGTCAACTTTGAGTTCGACACCACCATTGACGCCAAGAACGGTATCACCAAGTTCTGGATCAAGGAGACCAAGAAGTCTACC
AAGGTCAGCAAGTCTCACGACAACCAGGGCACCCACGGTTACAAGGTCGACGACACCGTCCTCTACCAGATCTCCGACTCCTGCCTTGCCGCCGACCAGCTGCCCAGCGCTCCCATGACT
ATCACCGCCGTTGTCCGTGACAGCCAGGCCAAGAACGCCCTGACCCTCAAGGCTGTTGACAGGGTTTCCCAGAAGGGAACTGTTGTTCCCAAGCTCCAGACTAAGGTTGTCCCCTTCAAG
GCCACTGGCAAGAAGGTCAACGGTTACACCACCTTCAAGGCCCAGACCAAGATCAACGACGACAACATCCGGTTCGACATTGCTCTTGCCGGAAACGCTGCTGCTGGCGTGCAGTTCCAG
GCAGCTCTTGCTGTTCCCCATGGCTCTTGCAAATAG

Retrieve as FASTA