Entry information : CcinAPx-CcP01
Entry ID 5365
Creation 2007-05-16 (Marcel Zamocky)
Last sequence changes 2007-05-16 (Marcel Zamocky)
Sequence status complete
Reviewer Laure Collomb
Last annotation changes 2010-08-13 (Marie Brette (Scipio))
Peroxidase information: CcinAPx-CcP01
Name CcinAPx-CcP01
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinAPx-CcP01
start..stop
S start..stop
LbiAPx-CcP 733 0 11..596 8..593
HsubAPx-CcP02 725 0 9..568 4..560
LameAPx-CcP01 725 0 11..596 8..587
HcyAPx-CcP02 715 0 22..599 21..597
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 764371..764592 222 N° 2 764643..764729 87 N° 3 764781..764847 67 N° 4 764901..765222 322
N° 5 765275..766385 1111  
join(764371..764592,764643..764729,764781..764847,764901..765222,765275..766385)


exon

Literature and cross-references CcinAPx-CcP01
Literature unpublished
DNA ref. JGI genome:   Chr_2 (764371..766382)
mRNA ref. GenBank:   XM_001832914
Cluster/Prediction ref. Genebank:   6009457
Protein sequence: CcinAPx-CcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   602 (578)
PWM (Da):   %s   66281.72 (63758.4)  
PI (pH):   %s   4.37 (4.34) Peptide Signal:   %s   cut: 25 range:25-602
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLQLSTTTTLAVLLSTFSTLSSAYTWPSPQYDALEALIYEGRTTAGSSLTALVHPCKKRVGTLASVPAEWLRFAFHDMATHNVDDGTGGMDGSIVYELGRAENFGSGFNQTLGDFENFPNKYLSRADIIAAGAVHSVATCGGPIIPFRGGRIDTFEAGGFGTPEPHHDLDTLTESFRRQGFSTPEMIKMVACGHTMGGVRSEEFPQLVPPGPDPSVMVIQDFDTTPDFDNKVVTEYLDGTTPNVLVNSPNRTLVSDLRVFSADGNNTMREIAPEDTFQSECRDILERMLNVVPRGVTLTEEITMLPVKVKNAQLTIEKEQLVFKSTLRLAQPLDEPVSKERVVTMFWCDRYGNNKDCEDSARSSVFVKRLTEDPDISPVTKNLGYSFYSYDFVVPINPAQSISKFWFEVDEKDGSRPTLHNNEGTDYPVEQDEIIFVPMMSSVNVISNGTDGKVVQNRNNLTGEFFYREYNLVVGVREDTEPDRVYVDGFDSSVLGFAYLVNTTIDLTLDDSLKPVAGYKFYTGQLDDSGLQLSIDLNLDVGGRTYRQDFVQTNVLDNTPYVAPGTVMSGDRPSSALALRDGWICSLVALSLSMVAVGYLS

Retrieve as FASTA  
Remarks Complete from genomic (4 introns). No EST available. Strain="okayama7#130".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGCTACAACTATCGACGACGACAACTCTTGCAGTTCTTCTTTCGACGTTCTCCACACTCAGTTCGGCGTATACATGGCCTTCACCGCAATACGATGCTCTTGAGGCTCTCATCTAC
GAGGGCAGGACGACTGCCGGTTCCAGCTTGACTGCACTCGTTCACCCTTGCAAGAAACGAGTTGGAACTTTGGCTTCTGTTCCTGCTGAATGGCTACGATTT
GTGAGTCCCATTTTATGT
ATGGCGGTAGATTTTTCTCATTGCTCTCGCAGGCTTTCCATGACATGGCTACACATAATGTCGACGACGGAACGGGCGGAATGGACGGTTCCATTGTCTACGAGCTCGGGCGAGCCGAGG
TGCGCACTCCCGCCGTATGTGTCTGTATGTCATGTTCATCTTGGGCCTAGAACTTTGGAAGCGGCTTCAACCAAACCCTCGGCGACTTTGAGAACTTTCCCAACAAATACCTCTCCCGTC
AGTCCCTCCTTTTCACCTCCATAATCCCATCTCATCTGGGTCTTCTTCAGGCGCGGACATCATAGCAGCAGGCGCCGTCCACTCCGTCGCAACATGTGGCGGGCCCATCATCCCCTTCCG
CGGCGGCCGCATCGACACCTTTGAGGCAGGCGGTTTCGGCACGCCCGAGCCCCACCACGACCTTGACACCCTCACCGAGAGCTTCCGCAGGCAAGGCTTCTCTACGCCAGAAATGATCAA
GATGGTTGCGTGTGGTCATACGATGGGTGGTGTGCGGAGTGAAGAGTTCCCCCAGCTCGTACCACCTGGACCGGATCCTAGCGTCATGGTCATCCAGGATTTCGATACCACTCCGGATTT
CGATAATAAAGT
GTGAGTGCTAGCGCAGCTGGTCTGGGGGAGGTAGTGCTGATGACTTGATTAGTGTGACAGAGTACCTGGACGGAACCACTCCTAATGTCCTCGTCAACTCTCCCAACC
GAACGCTCGTGAGCGACCTCCGCGTGTTCTCTGCGGATGGAAACAACACGATGCGCGAGATTGCCCCCGAAGACACCTTCCAATCCGAATGCCGCGACATCCTCGAACGAATGCTCAACG
TCGTTCCCCGAGGTGTTACTCTCACCGAGGAGATCACCATGCTCCCAGTCAAGGTCAAAAACGCCCAACTCACTATCGAGAAGGAGCAGCTGGTGTTCAAGTCTACTTTGCGGTTGGCCC
AGCCTCTGGACGAACCTGTTAGCAAGGAGCGCGTGGTTACCATGTTCTGGTGCGATCGATATGGGAACAACAAGGACTGCGAGGACAGCGCGAGGTCATCGGTCTTTGTCAAGAGGTTGA
CCGAGGATCCCGATATCTCTCCCGTTACCAAGAACCTCGGGTACTCGTTCTACAGCTACGACTTTGTCGTCCCCATCAACCCCGCCCAGTCCATCTCCAAATTCTGGTTCGAAGTCGACG
AGAAGGACGGCAGCCGACCTACGCTCCACAACAACGAAGGCACCGACTACCCCGTCGAGCAGGACGAAATCATCTTTGTGCCGATGATGAGTTCTGTGAACGTTATCTCGAACGGGACTG
ATGGCAAGGTTGTCCAGAATAGGAATAATTTGACGGGAGAGTTCTTCTATAGGGAGTATAACCTCGTCGTTGGTGTTAGGGAGGATACGGAGCCTGACCGTGTCTACGTCGACGGCTTCG
ACTCTTCCGTCCTCGGATTCGCATACCTCGTCAACACCACCATCGATCTCACCCTCGACGATTCTCTCAAGCCTGTTGCTGGATACAAGTTCTACACCGGCCAGTTGGACGATTCCGGTT
TGCAATTGTCGATTGATCTCAACTTGGACGTTGGAGGTAGGACCTACAGACAAGACTTTGTGCAGACGAATGTGTTGGATAATACCCCGTATGTTGCGCCTGGGACTGTTATGTCTGGGG
ATAGGCCGTCGAGTGCTTTGGCACTGAGGGATGGCTGGATCTGTTCCTTGGTTGCCCTATCTTTGTCTATGGTTGCTGTTGGGTATCTGTCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGCTACAACTATCGACGACGACAACTCTTGCAGTTCTTCTTTCGACGTTCTCCACACTCAGTTCGGCGTATACATGGCCTTCACCGCAATACGATGCTCTTGAGGCTCTCATCTAC
GAGGGCAGGACGACTGCCGGTTCCAGCTTGACTGCACTCGTTCACCCTTGCAAGAAACGAGTTGGAACTTTGGCTTCTGTTCCTGCTGAATGGCTACGATTT
GCTTTCCATGACATGGCT
ACACATAATGTCGACGACGGAACGGGCGGAATGGACGGTTCCATTGTCTACGAGCTCGGGCGAGCCGAG
AACTTTGGAAGCGGCTTCAACCAAACCCTCGGCGACTTTGAGAACTTTCCC
AACAAATACCTCTCCC
GCGCGGACATCATAGCAGCAGGCGCCGTCCACTCCGTCGCAACATGTGGCGGGCCCATCATCCCCTTCCGCGGCGGCCGCATCGACACCTTTGAGGCAGGCGGT
TTCGGCACGCCCGAGCCCCACCACGACCTTGACACCCTCACCGAGAGCTTCCGCAGGCAAGGCTTCTCTACGCCAGAAATGATCAAGATGGTTGCGTGTGGTCATACGATGGGTGGTGTG
CGGAGTGAAGAGTTCCCCCAGCTCGTACCACCTGGACCGGATCCTAGCGTCATGGTCATCCAGGATTTCGATACCACTCCGGATTTCGATAATAAAGT
TGTGACAGAGTACCTGGACGGA
ACCACTCCTAATGTCCTCGTCAACTCTCCCAACCGAACGCTCGTGAGCGACCTCCGCGTGTTCTCTGCGGATGGAAACAACACGATGCGCGAGATTGCCCCCGAAGACACCTTCCAATCC
GAATGCCGCGACATCCTCGAACGAATGCTCAACGTCGTTCCCCGAGGTGTTACTCTCACCGAGGAGATCACCATGCTCCCAGTCAAGGTCAAAAACGCCCAACTCACTATCGAGAAGGAG
CAGCTGGTGTTCAAGTCTACTTTGCGGTTGGCCCAGCCTCTGGACGAACCTGTTAGCAAGGAGCGCGTGGTTACCATGTTCTGGTGCGATCGATATGGGAACAACAAGGACTGCGAGGAC
AGCGCGAGGTCATCGGTCTTTGTCAAGAGGTTGACCGAGGATCCCGATATCTCTCCCGTTACCAAGAACCTCGGGTACTCGTTCTACAGCTACGACTTTGTCGTCCCCATCAACCCCGCC
CAGTCCATCTCCAAATTCTGGTTCGAAGTCGACGAGAAGGACGGCAGCCGACCTACGCTCCACAACAACGAAGGCACCGACTACCCCGTCGAGCAGGACGAAATCATCTTTGTGCCGATG
ATGAGTTCTGTGAACGTTATCTCGAACGGGACTGATGGCAAGGTTGTCCAGAATAGGAATAATTTGACGGGAGAGTTCTTCTATAGGGAGTATAACCTCGTCGTTGGTGTTAGGGAGGAT
ACGGAGCCTGACCGTGTCTACGTCGACGGCTTCGACTCTTCCGTCCTCGGATTCGCATACCTCGTCAACACCACCATCGATCTCACCCTCGACGATTCTCTCAAGCCTGTTGCTGGATAC
AAGTTCTACACCGGCCAGTTGGACGATTCCGGTTTGCAATTGTCGATTGATCTCAACTTGGACGTTGGAGGTAGGACCTACAGACAAGACTTTGTGCAGACGAATGTGTTGGATAATACC
CCGTATGTTGCGCCTGGGACTGTTATGTCTGGGGATAGGCCGTCGAGTGCTTTGGCACTGAGGGATGGCTGGATCTGTTCCTTGGTTGCCCTATCTTTGTCTATGGTTGCTGTTGGGTAT
CTGTCGTAG

Retrieve as FASTA