Entry information : CcinAPx-CcP02
Entry ID 5366
Creation 2007-05-16 (Marcel Zamocky)
Last sequence changes 2007-05-16 (Marcel Zamocky)
Sequence status complete
Reviewer Laure Collomb
Last annotation changes 2010-08-13 (Marie Brette (Scipio))
Peroxidase information: CcinAPx-CcP02
Name CcinAPx-CcP02
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP004]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinAPx-CcP02
start..stop
S start..stop
AbAPx-CcP02_bisporus 473 3e-163 4..466 129..600
CcinAPx-CcP01 451 7e-155 4..463 127..592
AthiAPx-CcP01 442 4e-151 4..418 124..552
AmusAPx-CcP01 442 4e-151 4..430 124..563
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1184459..1184781 323 N° 2 1184833..1184946 114 N° 3 1184995..1185169 175 N° 4 1185228..1185626 399
N° 5 1185679..1186071 393  
join(1184459..1184781,1184833..1184946,1184995..1185169,1185228..1185626,1185679 ..1186071)


exon

Literature and cross-references CcinAPx-CcP02
Literature unpublished
DNA ref. JGI genome:   Chr_2 (1184459..1186068)
Protein sequence: CcinAPx-CcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   467
PWM (Da):   %s   51004.27  
PI (pH):   %s   4.3
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGADVIAIGTILGVASCGGPIIPFRGGRIDALSADVAGVPEPHQDLETHTEIFRRQGFSQEEMIGLVACGHTMGGVRSSDFPDIVPPQDDSERFADFDDTHEFDNDVVVKYIDGTTQNPLVVHANMTLNSDLRIFESDGNATMRRLASPEDFSSTCGTLLEKMLNVVPSNVVLTEEITMLPVKVTDAHLTIENEQLVFKASLIAQPISAPNKNRLVKIFWCDRYGANKDCENRTGKTAGVASSPRIDDPQVSPLTFRAGFQFVHYDFIVPIDTEESLSKFWFEVDEKDGTKPKRHDNDGEGYVLQQDNVIYVPRLSSISFNREDRTQKTYYITAGGQEWCISFAGLYVCFR*CNRCI*HNYR*RRRHGAQRDTSVRCWIYFLFSKHRISRNPAYCRSTCSDRR*NVY*RLHADLLCCRKDSVHETNQRHHRRHRTPH*RFGQFCNCQHSIPGHYYWTVSSFGVYLL

Retrieve as FASTA  
Remarks Complete from genomic (4 introns). No EST available. Strain="okayama7#130".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGAGCGGACGTGATAGCAATCGGAACCATCCTCGGAGTCGCCTCTTGTGGAGGTCCAATCATTCCCTTTAGAGGAGGACGTATCGACGCTCTCTCTGCCGACGTGGCTGGGGTG
CCAGAACCACACCAAGACCTCGAGACACATACAGAGATCTTCCGCCGCCAAGGATTTAGTCAAGAAGAAATGATCGGCCTGGTCGCTTGTGGACACACCATGGGTGGTGTGCGAAGCTCG
GATTTCCCTGATATAGTTCCTCCCCAAGATGACTCCGAACGTTTTGCGGATTTCGATGACACCCATGAATTCGACAACGATGT
GTGAGTTCATGCCAACAGGTCTTTAGTAGCCTTCAAC
TAAACAAAGAACAGAGTCGTGAAGTATATCGACGGGACAACCCAGAATCCTCTCGTAGTGCATGCGAATATGACCCTCAACTCTGACTTGCGGATATTTGAAAGCGACGGCAATGCTACG
ATGCGGAG
GTACGCAGCCATCCTTTCATACCTCTTCGTCACTGACAATGCCTCTAGGCTCGCTTCCCCTGAAGACTTTTCCTCAACCTGCGGTACATTGTTGGAAAAAATGCTCAATGTC
GTCCCTTCGAATGTTGTCCTTACGGAGGAAATTACCATGTTGCCTGTCAAGGTCACCGACGCGCACTTGACCATTGAGAATGAGCAACTCGTTTTCAAGGCATCCCTGCGA
GTGAGTGCT
GCCACATGTGAATCATGATGAATGACCAAAAGTTGTTGACCCTGTGAAGATTGCCCAACCCATATCAGCGCCCAACAAGAACAGGCTGGTTAAGATCTTTTGGTGTGATCGTTATGGTGC
CAACAAGGACTGCGAAAATAGAACTGGGAAGACTGCAGGGGTCGCATCAAGTCCCAGGATCGACGACCCCCAAGTCTCGCCCCTCACATTTAGGGCTGGATTCCAGTTTGTCCACTACGA
CTTTATCGTCCCCATCGATACCGAGGAGTCGCTCTCAAAGTTCTGGTTCGAGGTGGATGAAAAGGACGGAACCAAGCCGAAGCGACACGACAACGACGGCGAAGGTTATGTTTTGCAGCA
GGACAACGTGATTTACGTACCTCGACTCAGCTCCATCTCTTTCAACCGGGAGGACCGCACCCAAAAGACTTATTATATCACCGCCGGT
GGTACGTACTTCCAATACATTGACCCTAGCTG
TCTCTGACTCCATTCTTTTAGGTCAAGAGTGGTGCATCTCCTTCGCGGGTCTATATGTCTGCTTTCGATAGTGCAACAGATGCATTTAGCACAATTATAGATGAAGACGTCGACATGGCG
CTCAACGAGACACTTCCGTCCGCTGCTGGATATACTTTCTATTCAGCAAGCATAGAATCTCCAGGAACCCAGCTTACTGTCGATCTACATGCAGTGATCGACGGTGAAACGTATACTGAA
GACTACATGCAGACCTTCTTTGTTGCAGGAAGGACTCCGTCCACGAAACCAACCAACGTCACCATCGTCGACATCGTACCCCCCACTAAAGATTTGGACAGTTCTGCAACTGCCAACATT
CTATCCCTGGACATTATTATTGGACTGTTAGCTCTTTCGGCGTTTATCTTCTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGAGCGGACGTGATAGCAATCGGAACCATCCTCGGAGTCGCCTCTTGTGGAGGTCCAATCATTCCCTTTAGAGGAGGACGTATCGACGCTCTCTCTGCCGACGTGGCTGGGGTG
CCAGAACCACACCAAGACCTCGAGACACATACAGAGATCTTCCGCCGCCAAGGATTTAGTCAAGAAGAAATGATCGGCCTGGTCGCTTGTGGACACACCATGGGTGGTGTGCGAAGCTCG
GATTTCCCTGATATAGTTCCTCCCCAAGATGACTCCGAACGTTTTGCGGATTTCGATGACACCCATGAATTCGACAACGATGT
AGTCGTGAAGTATATCGACGGGACAACCCAGAATCCT
CTCGTAGTGCATGCGAATATGACCCTCAACTCTGACTTGCGGATATTTGAAAGCGACGGCAATGCTACGATGCGGAG
GCTCGCTTCCCCTGAAGACTTTTCCTCAACCTGCGGTACATTG
TTGGAAAAAATGCTCAATGTCGTCCCTTCGAATGTTGTCCTTACGGAGGAAATTACCATGTTGCCTGTCAAGGTCACCGACGCGCACTTGACCATTGAGAATGAGCAACTCGTTTTCAAG
GCATCCCTGCGA
ATTGCCCAACCCATATCAGCGCCCAACAAGAACAGGCTGGTTAAGATCTTTTGGTGTGATCGTTATGGTGCCAACAAGGACTGCGAAAATAGAACTGGGAAGACTGCA
GGGGTCGCATCAAGTCCCAGGATCGACGACCCCCAAGTCTCGCCCCTCACATTTAGGGCTGGATTCCAGTTTGTCCACTACGACTTTATCGTCCCCATCGATACCGAGGAGTCGCTCTCA
AAGTTCTGGTTCGAGGTGGATGAAAAGGACGGAACCAAGCCGAAGCGACACGACAACGACGGCGAAGGTTATGTTTTGCAGCAGGACAACGTGATTTACGTACCTCGACTCAGCTCCATC
TCTTTCAACCGGGAGGACCGCACCCAAAAGACTTATTATATCACCGCCGGT
GGTCAAGAGTGGTGCATCTCCTTCGCGGGTCTATATGTCTGCTTTCGATAGTGCAACAGATGCATTTAG
CACAATTATAGATGAAGACGTCGACATGGCGCTCAACGAGACACTTCCGTCCGCTGCTGGATATACTTTCTATTCAGCAAGCATAGAATCTCCAGGAACCCAGCTTACTGTCGATCTACA
TGCAGTGATCGACGGTGAAACGTATACTGAAGACTACATGCAGACCTTCTTTGTTGCAGGAAGGACTCCGTCCACGAAACCAACCAACGTCACCATCGTCGACATCGTACCCCCCACTAA
AGATTTGGACAGTTCTGCAACTGCCAACATTCTATCCCTGGACATTATTATTGGACTGTTAGCTCTTTCGGCGTTTATCTTCTA

Retrieve as FASTA