Entry information : GmPrx52 (Glyma18g44310.1)
Entry ID 547
Creation 2006-01-17 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx52 (Glyma18g44310.1)
Name (synonym) GmPrx52 (Glyma18g44310.1)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Mature flowers
Seedlings
Inducers Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Sudden Death Syndrome disease
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx52
start..stop
S start..stop
GmPrx188 623 0 1..316 1..316
LjPrx10 525 0 1..316 1..316
AhPrx04 511 0 1..316 1..316
GrPrx38 506 0 4..316 8..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 54032444..54032650 207 N° 2 54033844..54034035 192 N° 3 54034210..54034375 166 N° 4 54035007..54035392 386
join(54032444..54032650,54033844..54034035,54034210..54034375,54035007..54035392 )


exon

Literature and cross-references GmPrx52 (Glyma18g44310.1)
Literature Public Soybean EST Project. Tyler,B. Not Published. Vodkin,L Functional Genomics Program for Soybean.
DNA ref. Phytozome 12:   Gm18 (54032444..54035392)
Protein sequence: GmPrx52 (Glyma18g44310.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (294)
PWM (Da):   %s   33326.62 (30724.1)  
PI (pH):   %s   8.65 (8.40) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MILPNIKVRFFLLFCLIGIVSAQLSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTSSFKGEKTAGPNAGSIRGFNVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGPTWTVQLGRRDSTTASLSSANSDLPAPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFRTRIYNDTNIDSSFAKSLQGNCPSTGGGSTLAPLDTTSPNTFDNAYFKNLQSKKGLLHSDQELFNGGSTDSQVNSYSSNPASFKTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 8 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTCTTCCAAACATCAAAGTTCGTTTTTTCTTACTCTTTTGCCTTATTGGGATAGTGTCAGCACAGTTATCCTCTACCTTTTATGGCAAAACGTGTCCTAATGCACTTTCAACCATT
AAATCAGAAGTAGTGTCTGCTGTGAACAACGAGCGTCGTATGGGAGCCTCGTTGCTCCGTCTTCATTTCCATGATTGCTTTGTTCAA
GCAAGTCAACTTTCACTATGTCCCTTTTTTCAT
TATGATTTATTTTCTCTTTCGGTACCATAAGATTATGCTTGAAGGCTTAACCTAATATATATGTATATGGGTTGCATTTACTATTTATGCACGTGTTCATATACACAAAAAAATAATCAT
TAGTTATACGAAAAAAATATATATTTTATCAAAACTACTTAGTCATTTTTCTTTTACATATATAATGTCATCGATACGACTTCAATTCGCGTATCTTGAAGAAAAAAAATCACACTTGTT
AACAATTTAAGAGATAATAATGTGATTAACTGTACTAAGCATCTCTTGAATTTGGTTCCTTCTTCAGTACAATTGTGCTTTAGTGTGATAAACTCTATTATTTGTATATACAAGCAAATA
ATCCAACACTTTATCACAGTAAATTTGACTAATTGTTACGTGTTGGATTTGGTTTGATAAAGTAAATTTTTAATGTTAGATTTAGTATGGCAAGGTATATAGTTATTTAATTATATATGA
GTCACTAAATGGTTTATTACTCTAAATACTGTTTGGTTTTACTACAAAGGAGCCGAACTTGCATTTTTGTTACATAGTTCATTGTGGAACTTTAGTCCTTATAATATCGTAAGTATTGTT
AGTTTTTTTTTATAATAAAAATTGACATTTTATTTTCTAGTCGTTGGTTTCTCTCGGTGACTAAAATCATTATCAATATAATGTCATTTTTTTTATTTATACTGTAGAACAACACAACAA
AACAAACCTATTATATCTAAGTTTTGTTCACATGTCTTACTATTAATTCAATGAACTGATCAATCGATATTATATTAAGAATTAAGAAATTTGTGAAATTATAAAAAGGTTGAATTTTCA
ACAAAAAGAAAACCACTTGCATAATAATTTATTTTAGAAATTCCATATACAAATTTAATTTCACATCAAAATATAATGGCTAAAAGTGGACTTTTCTGGCAACAAGCATTTGCTTCCAAA
TTGTCATGCAACGAAGTGATGTCGATCAGGCCAAGTCCACATCAAAAGAAAAAACAAAACACATGATAATCGTTCATTCATAATATTCTTTGGTGAAATGAAAATGACAACTAATTAATT
AATTAAAGTGAATTCGAAAATAATAATTCTCATTTTGTTCGTACCTAATTAATGCTTTTGTTTTTTGTTTTCCATGGCAGGGATGTGATGCATCAGTACTATTGGATGACACATCGAGTT
TCAAGGGTGAGAAGACAGCAGGTCCCAACGCTGGTTCGATTAGAGGTTTTAATGTAATAGACACCATAAAGTCTAAAGTGGAGAGCTTATGCCCTGGTGTTGTTTCTTGTGCTGATATCC
TTGCTGTAGCAGCAAGAGACTCGGTTGTAGCT
GTAAGTATATGTATATATTTCAGCTAGGTTAAATGGTGAAATTATTTTAATTTAACTAGTGATTCTGAGTTTCAGTTTTATATATGCA
ATTAGGTTAAATATTACATGTTTGATCTATAACTTAAAAACATATATACGAGTTAGGCACTTATATTGAACAAATTTAATTTTCAGCTTGGTGGACCTACTTGGACTGTGCAATTGGGTA
GAAGAGACTCAACCACTGCAAGTTTAAGTTCTGCTAACTCAGACTTGCCTGCTCCCACTTCAAGTTTAAGTGCCCTTATCAGTTCTTTCTCCAACAAAGGTTTTTCATCTAAAGAACTGG
TTGCTCTTTCAG
GTAGCTAGCTAGCTAGATGCATATTTAATTAATCCAGCATATGCATTAATTTTAATACATTTTTTTATGTACATTTTTTTAACATATTTTTTTATTAGTTTGAAATTT
ATGTACATTTTAAAACTAAGAATGGAGCTTGCCTATGAGTCTTACATCAATAATAAAAAAAAATTTTGAAACAAGTGTATAGCTAATATTAATTTCTCTTTCAAACATTGTATATTACAT
TTTGAAGAATATATACTAGTCAAATACTCTCTAATATTTTCTTTAATCTGTGGGTCACTCTATATGCATGGAACCATTCAAATGAGGAATACAACTAACATATTTAAGTAAGATTGACTC
ACATGAATTTCATGCGATTAAATAATGTGTTCGAGAGAAATTATGTGTTAGATAATATTTCTCGTTTCACCTCTTGATAAGAATGGACAATTTGATCCGAAAAATATGTCTATGATCAAA
TGTTATATTTAGTCTTCATGGGTGTTAGCAACACTTCTCAATCACCATGTCCAAAATTTATAATTTTTAATAAATTTTAGTTGATAATCAAGAGAGTATTACTTTTTTAGTTTTGCCAAT
TGCCTTGAACTTCTTTCTAATTTCTAATTAAAACCTATTTCAGGATCGCACACAATTGGGCAAGCTCAATGTTCAAGTTTCAGAACAAGGATTTACAACGACACCAACATAGATTCCTCT
TTTGCAAAATCATTGCAAGGAAATTGCCCTAGCACAGGTGGTGGCAGCACATTGGCCCCTCTTGACACCACCAGCCCAAACACCTTCGACAATGCTTACTTCAAGAACTTGCAGAGCAAA
AAGGGTCTCTTGCACTCAGATCAAGAGCTCTTCAACGGAGGATCCACAGACTCTCAAGTAAATTCCTACAGCAGTAATCCTGCAAGTTTCAAAACTGACTTTGCCAATGCAATGATTAAA
ATGGGGAACCTTAGTCCACTCACTGGGTCTAGTGGCCAAATTAGGACCAATTGTAGGAAGACCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTCTTCCAAACATCAAAGTTCGTTTTTTCTTACTCTTTTGCCTTATTGGGATAGTGTCAGCACAGTTATCCTCTACCTTTTATGGCAAAACGTGTCCTAATGCACTTTCAACCATT
AAATCAGAAGTAGTGTCTGCTGTGAACAACGAGCGTCGTATGGGAGCCTCGTTGCTCCGTCTTCATTTCCATGATTGCTTTGTTCAA
GGATGTGATGCATCAGTACTATTGGATGACACA
TCGAGTTTCAAGGGTGAGAAGACAGCAGGTCCCAACGCTGGTTCGATTAGAGGTTTTAATGTAATAGACACCATAAAGTCTAAAGTGGAGAGCTTATGCCCTGGTGTTGTTTCTTGTGCT
GATATCCTTGCTGTAGCAGCAAGAGACTCGGTTGTAGCT
CTTGGTGGACCTACTTGGACTGTGCAATTGGGTAGAAGAGACTCAACCACTGCAAGTTTAAGTTCTGCTAACTCAGACTTG
CCTGCTCCCACTTCAAGTTTAAGTGCCCTTATCAGTTCTTTCTCCAACAAAGGTTTTTCATCTAAAGAACTGGTTGCTCTTTCAG
GATCGCACACAATTGGGCAAGCTCAATGTTCAAGT
TTCAGAACAAGGATTTACAACGACACCAACATAGATTCCTCTTTTGCAAAATCATTGCAAGGAAATTGCCCTAGCACAGGTGGTGGCAGCACATTGGCCCCTCTTGACACCACCAGCCCA
AACACCTTCGACAATGCTTACTTCAAGAACTTGCAGAGCAAAAAGGGTCTCTTGCACTCAGATCAAGAGCTCTTCAACGGAGGATCCACAGACTCTCAAGTAAATTCCTACAGCAGTAAT
CCTGCAAGTTTCAAAACTGACTTTGCCAATGCAATGATTAAAATGGGGAACCTTAGTCCACTCACTGGGTCTAGTGGCCAAATTAGGACCAATTGTAGGAAGACCAACTAA

Retrieve as FASTA