Entry information : NhaeCP01 (NhaeKatG1)
Entry ID 5480
Creation 2007-07-06 (Marcel Zamocky)
Last sequence changes 2011-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-05-23 (Christophe Dunand)
Peroxidase information: NhaeCP01 (NhaeKatG1)
Name (synonym) NhaeCP01 (NhaeKatG1)
Class Catalase peroxidase    [Orthogroup: CP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Nectria
Organism Nectria haematococca    [TaxId: 140110 ]
Cellular localisation Secreted
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NhaeCP01
start..stop
S start..stop
GmoCP01 1281 0 3..760 43..800
FoCP01 1271 0 3..760 44..801
GzCP01 1258 0 1..760 42..801
TatCP01 1173 0 5..760 6..761
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 140640..140972 333 N° 2 141032..141256 225 N° 3 141307..141449 143 N° 4 141633..141662 30
N° 5 141842..143392 1551  
join(140640..140972,141032..141256,141307..141449,141633..141662,141842..143392)


exon

Literature and cross-references NhaeCP01 (NhaeKatG1)
Literature Coleman J.J., Rounsley, S.D., et al. (2009) The genome of Nectria haematococca: contribution of supernumerary chromosomes to gene expansion. PLoS Genet 5:E1000618-E1000618
DNA ref. GenBank:   ACJF01000038.1 (140640..143392) [Incorrect prediction]
EST ref. GenBank:   GE243157.1 [5' end]   GE238828.1 [Fragment]
Protein sequence: NhaeCP01 (NhaeKatG1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   760
PWM (Da):   %s   83727.06  
PI (pH):   %s   5.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSESKCPVAHRVINAAGHGQQNRNWWPDSLKTNILRQHTNVTNPRGENFDYAAAFKTLDYESLKKDLRELMTDSQEYWPADFGHYGGLFIRMSWHSVGTYRVFDGRGGGRQGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGNKISWADLIVLAGNVALEDMGFKTIGFAGGREDTWEAAEDVYWGGETTWLGNDVRYSDGHPGTSKAGAIDSDEAPHKDIHSRKLEEPLGAVHLGLIYVNPEGPDGNPDPVAAARDIRDTFGRMAMNDEETVALIAGGHSFGKTHGAGSSDHVGPEPEAAGLEAQGLGWSNTYKSGKGPDTTTSGLEVTWTKTPTKWSNNFFEYLFKFEWELTKSPAGAHQWVAKDAPEIIPDAYDPNKKQRPTMLTTDLSLRFDPEYEKISRRFLNNFDEFSEVFAKAWFKLTHRDMGPVSRYLGPEVPKESFLWQDPVPEVDFKLVDEGDVAAIKNEILKSGLSATQLASTAWASASTFRGSDLRGGANGARIRLEPQKDWEVNNPAQLSKVLSVLEGIQQKFNNAQPNGKRISLADVIVLAGSAGVEKAAKDAGFFVSVPFTPGRTDATQEQTDVQSANYLKPSVDGFRNYGQSTPRVKLEHLLIDRAQLLTLSLPELTALIGGLRALNANWDGSSHGIFTDRPGALTNDFFVNLLDMGTVWKPVGDGDIFEGSDRKTGAKKWTGTRVDLVFGSHAELRALSEVYAEAGGDEKLVKDFVAAWVKVMNLDRFDIGKAPTLNVSPRL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 11, 3 introns) and 23 ESTs. Incorrect splicing predictions are confirmed with ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGAGTCCAAGTGCCCCGTTGCTCATAGAGTCATCAACGCTGCTGGCCACGGCCAGCAGAACCGCAACTGGTGGCCCGATTCTCTCAAGACCAACATCTTGAGACAACACACAAAC
GTCACCAACCCCCGAGGCGAGAATTTCGACTATGCTGCTGCTTTCAAGACCCTCGACTATGAGAGTCTCAAGAAGGACCTGCGAGAGCTCATGACCGACTCGCAGGAGTACTGGCCTGCT
GATTTCGGCCACTACGGCGGTCTCTTCATCCGAATGTCGTGGCACAGCGTCGGTACCTACCGAGTATTTGATGGCCGAGGAGGTGGCCGACAG
GTATGCGCCAACAACCAGGCCAATAAA
CCTTGCTCCAGCTAACATCAATTGCTCTTCAGGGACAACAACGATTCGCTCCCCTCAACAGCTGGCCCGATAACGTCTCTCTCGACAAGGCCCGTCGCCTGCTCTGGCCGATCAAGCAGA
AGTACGGAAACAAGATCTCATGGGCCGACCTGATTGTCCTCGCTGGCAATGTCGCCCTTGAAGATATGGGCTTCAAGACCATCGGCTTCGCCGGTGGCCGCGAGGACACCTGGGAGGCGG
CAGAGGATGTTTATTGG
CGAGTCTCTTTCTACAATATCTTGCTCTCGCAATTGCTAACTAGCAGACAGGGGAGGCGAGACCACCTGGCTGGGCAACGACGTCCGTTATTCTGATGGTCAT
CCTGGCACATCGAAGGCCGGTGCCATCGATTCTGATGAGGCTCCTCACAAGGACATCCACAGCCGCAAGCTTGAGGAGCCCCTCGGCGCA
GTTCGTAAGTTCATTTCACTCATCCACTGT
TAACCATATGCTAACCGTGTAACTAGATGTAAGTTCAATCCAGCTGTGGTCGAAGCAGGTGTGGTGTTTTCCCTCACCAGCTGACCTCCACCATCCACCATCGCAACCTTATAAGAACAT
TACTAATCGTATTCTGCTTACGTAATCGAAAAGTTAGGCTTGATTTATGTGAATCCCGGTTTGTACGCCTTTTCCTTGCGTTTCTGAGTGTTTTATTCATTGTAGTATCATGTGGTGGCA
TCGTGGGGTTGATTGGGAGCTTGGTTGACCATCTTGGTTGACCGAGTTGGCGATGACCTCACTTTGCCAGCACGTGAGATTACCCGTATTTGTGGGGCTAATTGCTGACTAAATCTACAG
AGGGTCCTGATGGCAACCCCGATCCCGTGGCTGCTGCTCGAGACATCCGCGATACCTTTGGCCGCATGGCCATGAACGATGAGGAGACCGTTGCCCTCATTGCCGGAGGCCACTCTTTCG
GAAAGACCCACGGAGCTGGTTCATCCGACCATGTCGGTCCCGAGCCCGAGGCTGCAGGCCTTGAGGCGCAGGGCCTCGGCTGGTCCAACACTTACAAGTCCGGAAAGGGTCCCGACACCA
CCACCAGTGGACTCGAGGTTACCTGGACGAAGACTCCCACCAAGTGGAGCAACAACTTCTTCGAGTACCTCTTCAAGTTTGAGTGGGAGCTCACCAAGAGTCCCGCCGGTGCTCACCAGT
GGGTGGCCAAGGATGCTCCCGAGATCATCCCCGATGCCTACGACCCCAACAAGAAGCAGCGCCCTACCATGCTGACCACCGATCTTTCTCTCCGCTTCGACCCCGAGTATGAGAAGATCT
CCCGACGCTTCCTCAACAACTTTGACGAGTTCTCCGAGGTCTTTGCCAAGGCTTGGTTCAAGCTTACCCACCGTGACATGGGTCCCGTGTCGCGCTACCTCGGTCCCGAGGTTCCCAAGG
AGAGCTTCTTGTGGCAAGACCCCGTTCCCGAGGTCGACTTTAAGCTGGTCGATGAGGGCGATGTCGCTGCCATCAAGAACGAGATCCTCAAGTCTGGCTTGAGTGCCACTCAATTGGCCT
CTACTGCCTGGGCCTCCGCCTCTACCTTCCGAGGCAGTGACCTTCGCGGTGGTGCCAACGGTGCCCGTATCCGCCTTGAGCCCCAGAAGGACTGGGAGGTCAACAACCCTGCCCAGCTCA
GCAAGGTTCTCAGCGTCCTTGAGGGCATCCAGCAGAAGTTCAACAACGCTCAGCCCAACGGCAAGCGCATCTCTCTTGCTGATGTCATTGTCCTCGCTGGTTCTGCCGGTGTTGAGAAGG
CTGCCAAGGACGCTGGCTTCTTTGTCTCGGTCCCCTTCACTCCCGGTCGCACCGATGCCACCCAGGAGCAGACCGACGTCCAGTCCGCCAACTACCTCAAGCCCTCTGTTGATGGCTTCC
GAAACTACGGACAGTCGACACCACGTGTCAAGCTTGAGCACCTGCTCATTGACCGAGCTCAGCTTCTGACTCTGTCCCTGCCCGAGCTGACCGCCCTCATCGGTGGTCTCCGTGCCCTCA
ACGCCAACTGGGATGGCTCCTCCCACGGTATCTTCACTGACCGCCCCGGCGCTCTCACCAACGACTTCTTCGTCAACCTTCTCGACATGGGCACCGTCTGGAAGCCCGTTGGCGATGGCG
ACATCTTCGAGGGATCCGACCGCAAGACCGGAGCCAAGAAGTGGACCGGTACCCGCGTCGACCTTGTCTTTGGCTCTCACGCCGAGCTCCGCGCTCTGTCGGAGGTGTACGCCGAGGCTG
GTGGTGATGAGAAGCTGGTCAAGGACTTCGTGGCTGCTTGGGTCAAGGTGATGAACCTGGACCGATTCGACATTGGCAAGGCGCCTACGCTGAACGTTTCTCCTCGTCTGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGAGT CCAAGTGCCC CGTTGCTCAT AGAGTCATCA ACGCTGCTGG CCACGGCCAG CAGAACCGCA ACTGGTGGCC CGATTCTCTC AAGACCAACA TCTTGAGACA ACACACAAAC  GTCACCAACC CCCGAGGCGA GAATTTCGAC TATGCTGCTG CTTTCAAGAC CCTCGACTAT GAGAGTCTCA AGAAGGACCT GCGAGAGCTC ATGACCGACT CGCAGGAGTA CTGGCCTGCT  GATTTCGGCC ACTACGGCGG TCTCTTCATC CGAATGTCGT GGCACAGCGT CGGTACCTAC CGAGTATTTG ATGGCCGAGG AGGTGGCCGA CAGGGACAAC AACGATTCGC TCCCCTCAAC  AGCTGGCCCG ATAACGTCTC TCTCGACAAG GCCCGTCGCC TGCTCTGGCC GATCAAGCAG AAGTACGGAA ACAAGATCTC ATGGGCCGAC CTGATTGTCC TCGCTGGCAA TGTCGCCCTT  GAAGATATGG GCTTCAAGAC CATCGGCTTC GCCGGTGGCC GCGAGGACAC CTGGGAGGCG GCAGAGGATG TTTATTGGGG AGGCGAGACC ACCTGGCTGG GCAACGACGT CCGTTATTCT  GATGGTCATC CTGGCACATC GAAGGCCGGT GCCATCGATT CTGATGAGGC TCCTCACAAG GACATCCACA GCCGCAAGCT TGAGGAGCCC CTCGGCGCAG TTCATTTAGG CTTGATTTAT  GTGAATCCTG AGGGTCCTGA TGGCAACCCC GATCCCGTGG CTGCTGCTCG AGACATCCGC GATACCTTTG GCCGCATGGC CATGAACGAT GAGGAGACCG TTGCCCTCAT TGCCGGAGGC  CACTCTTTCG GAAAGACCCA CGGAGCTGGT TCATCCGACC ATGTCGGTCC CGAGCCCGAG GCTGCAGGCC TTGAGGCGCA GGGCCTCGGC TGGTCCAACA CTTACAAGTC CGGAAAGGGT  CCCGACACCA CCACCAGTGG ACTCGAGGTT ACCTGGACGA AGACTCCCAC CAAGTGGAGC AACAACTTCT TCGAGTACCT CTTCAAGTTT GAGTGGGAGC TCACCAAGAG TCCCGCCGGT  GCTCACCAGT GGGTGGCCAA GGATGCTCCC GAGATCATCC CCGATGCCTA CGACCCCAAC AAGAAGCAGC GCCCTACCAT GCTGACCACC GATCTTTCTC TCCGCTTCGA CCCCGAGTAT  GAGAAGATCT CCCGACGCTT CCTCAACAAC TTTGACGAGT TCTCCGAGGT CTTTGCCAAG GCTTGGTTCA AGCTTACCCA CCGTGACATG GGTCCCGTGT CGCGCTACCT CGGTCCCGAG  GTTCCCAAGG AGAGCTTCTT GTGGCAAGAC CCCGTTCCCG AGGTCGACTT TAAGCTGGTC GATGAGGGCG ATGTCGCTGC CATCAAGAAC GAGATCCTCA AGTCTGGCTT GAGTGCCACT  CAATTGGCCT CTACTGCCTG GGCCTCCGCC TCTACCTTCC GAGGCAGTGA CCTTCGCGGT GGTGCCAACG GTGCCCGTAT CCGCCTTGAG CCCCAGAAGG ACTGGGAGGT CAACAACCCT  GCCCAGCTCA GCAAGGTTCT CAGCGTCCTT GAGGGCATCC AGCAGAAGTT CAACAACGCT CAGCCCAACG GCAAGCGCAT CTCTCTTGCT GATGTCATTG TCCTCGCTGG TTCTGCCGGT  GTTGAGAAGG CTGCCAAGGA CGCTGGCTTC TTTGTCTCGG TCCCCTTCAC TCCCGGTCGC ACCGATGCCA CCCAGGAGCA GACCGACGTC CAGTCCGCCA ACTACCTCAA GCCCTCTGTT  GATGGCTTCC GAAACTACGG ACAGTCGACA CCACGTGTCA AGCTTGAGCA CCTGCTCATT GACCGAGCTC AGCTTCTGAC TCTGTCCCTG CCCGAGCTGA CCGCCCTCAT CGGTGGTCTC  CGTGCCCTCA ACGCCAACTG GGATGGCTCC TCCCACGGTA TCTTCACTGA CCGCCCCGGC GCTCTCACCA ACGACTTCTT CGTCAACCTT CTCGACATGG GCACCGTCTG GAAGCCCGTT  GGCGATGGCG ACATCTTCGA GGGATCCGAC CGCAAGACCG GAGCCAAGAA GTGGACCGGT ACCCGCGTCG ACCTTGTCTT TGGCTCTCAC GCCGAGCTCC GCGCTCTGTC GGAGGTGTAC  GCCGAGGCTG GTGGTGATGA GAAGCTGGTC AAGGACTTCG TGGCTGCTTG GGTCAAGGTG ATGAACCTGG ACCGATTCGA CATTGGCAAG GCGCCTACGC TGAACGTTTC TCCTCGTCTG 
TAA 

Retrieve as FASTA