Entry information : GmPrx55 (Glyma12g32170.1)
Entry ID 550
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx55 (Glyma12g32170.1)
Name (synonym) GmPrx55 (Glyma12g32170.1)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx55
start..stop
S start..stop
GmPrx11 652 0 1..326 1..326
GmPrx86 642 0 1..326 1..326
GmPrx12 638 0 3..326 1..324
LjPrx13 573 0 1..326 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35724304..35724513 210 N° 2 35724605..35724793 189 N° 3 35724932..35725094 163 N° 4 35725689..35726107 419
join(35724304..35724513,35724605..35724793,35724932..35725094,35725689..35726107 )


exon

Literature and cross-references GmPrx55 (Glyma12g32170.1)
Literature Public Soybean EST Project. Vodkin,L Functional Genomics Program for Soybean.
DNA ref. Phytozome 12:   Gm12 (35724304..35726107)
Protein sequence: GmPrx55 (Glyma12g32170.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   35778.42 (33200.1)  
PI (pH):   %s   8.33 (8.02) Peptide Signal:   %s   cut: 24 range:24-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMGSNFRFLSLCLLALIASSHAQLQLGFYAKSCPKAEQIILKFVHEHIHNAPSLAAALIRMHFHDCFVRGCDGSVLLNSTTNQAEKNAPPNLTVRGFDFIDRIKSLVEAECPGVVSCADILTLASRDSIVATGGPYWKVPTGRRDGVISNLVEARNNIPAPFDNITTLQTLFANQGLDLKDLVLLSGAHTIGIAHCSSLSNRLFNFTGKGDQDPSLDSEYAANLKTFKCKDLNKLNTTKIEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVEKFFAEFATSIEKMGRIKVKTGTEGEIRKHCAFVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGGGAAGCAACTTCAGGTTTTTGAGTCTTTGCCTCTTGGCATTGATTGCATCATCTCATGCTCAACTTCAGCTTGGTTTTTATGCCAAGAGTTGCCCAAAAGCTGAGCAAATC
ATTTTGAAATTTGTTCATGAACATATCCACAATGCTCCATCACTAGCAGCTGCATTGATAAGAATGCACTTCCATGACTGTTTTGTAAGG
GTATGTGGTTCAAGCCTATACTTACCTTTC
ATTTTTACTTAACAAGCATACTATGTTAGATTAAGGAGCTAACTAACATGAAGCATTTCAGGGATGTGATGGATCGGTGCTTCTGAACTCAACAACCAATCAGGCTGAAAAGAATGCTCC
TCCAAATCTCACAGTTAGAGGCTTTGACTTCATTGACAGAATAAAGAGCCTTGTTGAGGCTGAATGCCCTGGTGTGGTCTCTTGTGCTGATATCCTCACCTTGGCTTCCAGAGATTCAAT
TGTAGCCACA
GTAAGTGCTCAATTTCTATCAAGAAAATCTTAAGAGTATAAGTACAACTTCTGCTTCACCTTTATTATCTTTATACTTTCTTTTTGAGAACAAGAATAACCCATTTGCGG
GTTTGTGCCATTACTGACTGATTTTCAGGGTGGACCCTATTGGAAAGTTCCAACAGGTCGAAGGGATGGGGTCATCTCTAACTTGGTGGAAGCCAGAAATAACATTCCTGCTCCATTTGA
CAACATCACTACGCTACAGACACTCTTTGCCAACCAAGGACTTGATTTGAAGGACTTGGTCCTGCTCTCTG
GTATTATTTGAAAGGCTTAAATATGTTTTTAATCTCTCAAATTTAAAAT
AAGTTTAATTTTGGTCTTCCTAATTTCAAATTGATCTTTTTATTCCATATAATTTGAAGAATGTCTTTTTTAGTGGCTCAACGTAAATGTTCTTAGAGACTTGGCTTATGTAGCTAACAA
ATTATAAGTTGTTTACATGACAAAAGATTAATTTTATATTTGGAGGAAAAAAACAAATTCATTTTGATTTTGCATTTTGAGCAGAGGGACTAAAACACACTCTTTTTTTTCAAGTTATAT
GGACAAAAGATTAATTTTATATTTGGAGGAAAAAAACAAATTTATCGAAATAACTAAAAACATATTTAAGCTTGATTGAAAATACACCTAAATATTTAGAGTTTGAAGTGGATAATTTTG
TTTTTAAGGAATTTGTTAATTATCTTTCAAAACTTTAGAATGCTGTTTAGATAAAGATAAAAATAAGTGTCTTGTTCCTATCATTCATGCTTGCCTATTTGCTTTTAAGGTTAGAACGTT
GTTAGTATTTGAATTTTGTGTCTTGTTCTTGTGCTTGTAATCACCAAGAGTTCAAATTGTTTCAGGTGCTCACACAATTGGTATCGCTCATTGCTCATCATTGTCAAACCGCTTGTTCAA
TTTCACTGGCAAGGGTGATCAAGACCCATCATTAGACAGTGAATATGCTGCAAATCTGAAAACCTTCAAGTGCAAGGACCTCAATAAGTTGAACACCACCAAAATTGAGATGGACCCTGG
AAGTCGCAAGACATTTGATCTTAGCTACTATAGTCACGTTATTAAGAGAAGGGGTCTATTTGAGTCAGATGCTGCATTGTTGACTAATTCAGTTACAAAGGCTCAAATCATTGAATTGCT
TGAAGGGTCAGTTGAAAAATTCTTTGCTGAGTTTGCAACCTCCATAGAGAAAATGGGAAGAATTAAGGTGAAGACAGGGACAGAGGGAGAGATCAGAAAGCATTGTGCATTTGTTAATAG
CTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGGGAAGCAACTTCAGGTTTTTGAGTCTTTGCCTCTTGGCATTGATTGCATCATCTCATGCTCAACTTCAGCTTGGTTTTTATGCCAAGAGTTGCCCAAAAGCTGAGCAAATC
ATTTTGAAATTTGTTCATGAACATATCCACAATGCTCCATCACTAGCAGCTGCATTGATAAGAATGCACTTCCATGACTGTTTTGTAAGG
GGATGTGATGGATCGGTGCTTCTGAACTCA
ACAACCAATCAGGCTGAAAAGAATGCTCCTCCAAATCTCACAGTTAGAGGCTTTGACTTCATTGACAGAATAAAGAGCCTTGTTGAGGCTGAATGCCCTGGTGTGGTCTCTTGTGCTGAT
ATCCTCACCTTGGCTTCCAGAGATTCAATTGTAGCCACA
GGTGGACCCTATTGGAAAGTTCCAACAGGTCGAAGGGATGGGGTCATCTCTAACTTGGTGGAAGCCAGAAATAACATTCCT
GCTCCATTTGACAACATCACTACGCTACAGACACTCTTTGCCAACCAAGGACTTGATTTGAAGGACTTGGTCCTGCTCTCTG
GTGCTCACACAATTGGTATCGCTCATTGCTCATCATTG
TCAAACCGCTTGTTCAATTTCACTGGCAAGGGTGATCAAGACCCATCATTAGACAGTGAATATGCTGCAAATCTGAAAACCTTCAAGTGCAAGGACCTCAATAAGTTGAACACCACCAAA
ATTGAGATGGACCCTGGAAGTCGCAAGACATTTGATCTTAGCTACTATAGTCACGTTATTAAGAGAAGGGGTCTATTTGAGTCAGATGCTGCATTGTTGACTAATTCAGTTACAAAGGCT
CAAATCATTGAATTGCTTGAAGGGTCAGTTGAAAAATTCTTTGCTGAGTTTGCAACCTCCATAGAGAAAATGGGAAGAATTAAGGTGAAGACAGGGACAGAGGGAGAGATCAGAAAGCAT
TGTGCATTTGTTAATAGCTAA

Retrieve as FASTA