Entry information : GmPrx59 (Glyma17g29320.1)
Entry ID 558
Creation 2006-07-27 (Christophe Dunand)
Last sequence changes 2011-10-07 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx59 (Glyma17g29320.1)
Name (synonym) GmPrx59 (Glyma17g29320.1)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Immature seed coats
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx59
start..stop
S start..stop
LjPrx70 571 0 1..326 1..327
CpapPrx22 506 0 22..326 19..323
EgrPrx68 486 8e-175 12..326 11..325
EglPrx68 486 8e-175 12..326 11..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 31772845..31773054 210 N° 2 31773161..31773358 198 N° 3 31773931..31774096 166 N° 4 31774657..31775063 407
join(31772845..31773054,31773161..31773358,31773931..31774096,31774657..31775063 )


exon

Literature and cross-references GmPrx59 (Glyma17g29320.1)
Literature Public Soybean EST.
DNA ref. Phytozome 11:   Gm17 (31772845..31775063)
Protein sequence: GmPrx59 (Glyma17g29320.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   36101.44 (33454.1)  
PI (pH):   %s   9.15 (9.44) Peptide Signal:   %s   cut: 24 range:24-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MCSHSLIFHANLFLLLLIVGCHAQLRVDYYKNTCPNVESIVRSAVEKKLQQTFVTAPATLRLFFHDCFVRGCDASVMLATRNNTSEKDNPINLSLAGDGFDTVIKAKAAVDSVPGCQNKVSCADILALATRDVIALAGGPSYAVELGRLDGRVSTKASVRHHLPHPEFKLEQLNQMFASHGLTLTDLVALSGAHTIGFSHCSQFSKRIYNFRRRKSIDHTLNPTYAKQLQQVCPKNVDPRLAIDMDPVTPRTFDNQYYKNLQQGRGLLASDQALFTHKRTRDLVNLFASNNTAFEASFVSAMMKLGRIGVKTGNQGEIRHDCTMIN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGTTCCCATAGCCTCATTTTCCATGCTAACTTGTTTCTTCTGCTGCTAATAGTTGGTTGTCATGCTCAACTTCGAGTTGATTACTACAAAAACACATGTCCAAATGTTGAATCGATT
GTACGAAGTGCGGTTGAGAAGAAACTTCAGCAGACATTTGTGACAGCTCCTGCTACACTTAGGCTCTTCTTCCATGATTGTTTTGTTAGG
GTCAGAATAGTTACAACTGTAACTTATAAT
CTCTCCTTTTTTTTTTCTATTTGCATGCACCTCTTTGGCAATAGGTGTTACTAAACCTTTTGTGCATGTTGGATAGGGATGTGATGCATCTGTGATGCTAGCTACAAGAAACAACACATC
AGAGAAGGATAATCCTATAAATCTTTCACTAGCTGGTGATGGATTTGACACTGTGATCAAAGCCAAGGCTGCGGTTGACAGTGTACCTGGCTGCCAGAATAAGGTTTCATGTGCTGACAT
ATTGGCATTGGCAACTAGAGACGTCATAGCATTG
GTAAATAAGCAATAGCCTTGGCAAAATATAGAGAGCTTCCAATTAATATGCATAAAAATAAATTGTATCCTTTATAAACTAACTAG
TTGTCTCTATTATAAGTAACAGTGGGGTAGGAATTAGAGAACACAAAATGAATCAGCAACAACTGAGGAAAATATGAAAAAAAAAATCAGTTAAAGATGTTGGAGGCACTAGTAAGCAGA
GTAGATTGCATAGTTTTTAGACATGTAAAGAGGGGGAGACCAAGGACATTGGAGGAAGTTGTTAAGAGGATATGAGGGAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGGTAGAGTTAGACAAGTATTACTAGAATGTTAGGATCCCTGCATACTCCATAGAGT
ATCATATTTCTTTTGATTTGTCTTTATAAAGTTATTTTATTTTGGCTATGTGGAAGATTATATGTGGCATTTTATTCCTTGTACAATTTAGCTGAACACCATATGAAACATAACACTTGG
TTTCAGGCAGGAGGACCATCTTATGCAGTAGAGTTGGGAAGGCTAGATGGGAGAGTCTCAACAAAAGCCAGTGTTAGACACCATCTACCTCATCCTGAATTCAAACTAGAACAGCTGAAC
CAAATGTTTGCTTCACATGGCCTCACCCTTACGGATCTAGTTGCTCTATCAG
GTATTTCATTCATACTGAACACAATACAAGTTTGATATCCAAGAGTTTTTTAAGCTTGTTTTTGGATA
TACACCGGGATTGCTCAAACCTATGTTTTGCAATAGCCAATTTTCAACTTGTTTGGTTTTATGTTGGCATCAAGTCTCAAAGTGAATTTTAACTCTCAAATCAATCATGAAAAGAAGCAA
GTCTTGTGCAAGTTATGCATTAGGTTGTAAAAATTATACTACTTTTTATGATAAAAGTTTCCAACATAATCACTTCACTTAAAACTCACTTTTAGCCGAAATCAGTTTTACAAGATCAAG
ATACTCCAAATACACTTTATAAATGCCTATTTGAACACACACACAGAGACATAATCACATAAGTCCTATTTTGGACAAATTTCTTGATAACAACTTCTAAGAGAAGAAAAGAAGATAAAA
CGAATTAAGTTTTTCTCACAAGTTAAAATAAACTTAAACATATGTTAAAATCAGTTTCTAGAAAAGTTAAATGAGAAAACTTCTATAAATTAACTTATGCATCCGGCAAAATTTGTTTAC
TATTGATTGCAGGAGCACATACAATCGGGTTCTCTCACTGCAGCCAGTTCTCCAAACGGATTTACAACTTCAGAAGAAGGAAAAGCATTGATCACACACTGAATCCTACGTATGCAAAAC
AGCTCCAGCAAGTGTGTCCAAAAAATGTGGACCCCAGATTAGCCATTGACATGGACCCAGTTACACCTAGGACATTTGATAACCAATACTACAAGAATCTTCAGCAAGGAAGAGGACTCC
TTGCCTCTGATCAAGCTTTGTTTACTCATAAAAGAACAAGAGACCTAGTGAACTTATTTGCATCCAACAACACAGCCTTTGAAGCTTCTTTTGTAAGTGCCATGATGAAGCTAGGACGGA
TTGGGGTCAAAACGGGAAACCAGGGTGAAATTAGGCATGATTGCACAATGATTAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGTTCCCATAGCCTCATTTTCCATGCTAACTTGTTTCTTCTGCTGCTAATAGTTGGTTGTCATGCTCAACTTCGAGTTGATTACTACAAAAACACATGTCCAAATGTTGAATCGATT
GTACGAAGTGCGGTTGAGAAGAAACTTCAGCAGACATTTGTGACAGCTCCTGCTACACTTAGGCTCTTCTTCCATGATTGTTTTGTTAGG
GGATGTGATGCATCTGTGATGCTAGCTACA
AGAAACAACACATCAGAGAAGGATAATCCTATAAATCTTTCACTAGCTGGTGATGGATTTGACACTGTGATCAAAGCCAAGGCTGCGGTTGACAGTGTACCTGGCTGCCAGAATAAGGTT
TCATGTGCTGACATATTGGCATTGGCAACTAGAGACGTCATAGCATTG
GCAGGAGGACCATCTTATGCAGTAGAGTTGGGAAGGCTAGATGGGAGAGTCTCAACAAAAGCCAGTGTTAGA
CACCATCTACCTCATCCTGAATTCAAACTAGAACAGCTGAACCAAATGTTTGCTTCACATGGCCTCACCCTTACGGATCTAGTTGCTCTATCAG
GAGCACATACAATCGGGTTCTCTCAC
TGCAGCCAGTTCTCCAAACGGATTTACAACTTCAGAAGAAGGAAAAGCATTGATCACACACTGAATCCTACGTATGCAAAACAGCTCCAGCAAGTGTGTCCAAAAAATGTGGACCCCAGA
TTAGCCATTGACATGGACCCAGTTACACCTAGGACATTTGATAACCAATACTACAAGAATCTTCAGCAAGGAAGAGGACTCCTTGCCTCTGATCAAGCTTTGTTTACTCATAAAAGAACA
AGAGACCTAGTGAACTTATTTGCATCCAACAACACAGCCTTTGAAGCTTCTTTTGTAAGTGCCATGATGAAGCTAGGACGGATTGGGGTCAAAACGGGAAACCAGGGTGAAATTAGGCAT
GATTGCACAATGATTAACTGA

Retrieve as FASTA