Entry information : PnoGPx
Entry ID 5589
Creation 2007-07-24 (Christophe Dunand)
Last sequence changes 2011-11-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PnoGPx
Name PnoGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Phaeosphaeriaceae Phaeosphaeria
Organism Phaeosphaeria nodorum (Stagonospora nodorum)    [TaxId: 13684 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PnoGPx
start..stop
S start..stop
Ssrc1lsm3aGPx01 335 4e-119 55..224 1..170
AalteGPx01 337 6e-119 1..219 1..236
ClunGPx01 317 2e-112 55..223 1..169
CheGPx01_C5 316 6e-112 55..219 1..165
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 52547..52751 205 N° 2 52834..53028 195 N° 3 53120..53394 275  
join(52547..52751,52834..53028,53120..53394)


exon

Literature and cross-references PnoGPx
Literature Birren BW et al., Annotation of the Phaeosphaeria nodorum SN15 genome.
Protein ref. GenPept:   EAT81791 UniProtKB:   Q0UCW7
DNA ref. JGI genome:   scaffold_17 (52547..53394)
EST ref. GenBank:   EH396957.1 [5' end]   EH397646.1 [3' end]
Protein sequence: PnoGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   24935.12  
PI (pH):   %s   10.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIRAASTAPRRILATSLRIKHKHLTPPLTTRLCVAIVTPTTRTYTRLRRATYATMSSATSFFDFKPADKKGQPYDLAKLNNKVVLVVNTASKCGFTPQFAGLEKLYKDLKAQYPDDFEILGFPCNQFGGQDPGSNDEIQSFCQVNYGVSFPVLGKVDVNGDKADPAFEWLKNEKPGLMGLKRVKWNFEKFLIGRDGKVKGRWASTKKPEDLKADIEKEIKAGKA

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and 11 ESTs. Strain="SN15".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTCGAGCAGCGAGCACAGCCCCGCGACGCATCCTTGCGACGAGTTTGCGCATCAAACATAAACACCTGACACCACCTCTCACTACTCGACTTTGTGTAGCTATTGTAACTCCCACT
ACGCGAACGTATACACGGCTGCGACGAGCAACATACGCAACCATGTCTTCCGCAACTTCCTTCTTCGACTTTAAGCCCGCGGACA
GTACGTTGCTCTCCCAGCAGCAAACACCCCGCCCG
CACATCCGCGCCCTTGTACAGGTCACCCCGCTAACATGATGTAATAGAGAAGGGCCAACCCTACGACCTGGCCAAGCTGAACAACAAAGTCGTCCTCGTCGTCAACACAGCCTCCAAGTG
CGGCTTCACACCGCAATTCGCCGGCCTCGAGAAGCTGTACAAGGACCTGAAGGCGCAATACCCGGATGACTTTGAGATACTCGGATTCCCTTGCAACCAGTTTGGCGGACAGGATCCTGG
AT
GTGAGTGTCCCCTGCCCTTCTCCCCCTCACAGCGGGCTAGGCTAGGCTAGGTCAGGTCAGGTCAGGTCAGTCACTAATACATGGCACCCAGCAAACGACGAGATCCAATCCTTTTGCC
AGGTCAACTACGGCGTGTCCTTCCCCGTGCTCGGCAAAGTGGACGTCAACGGCGACAAGGCAGACCCGGCGTTTGAGTGGCTGAAGAACGAGAAGCCCGGGCTCATGGGGCTCAAGCGCG
TCAAGTGGAACTTTGAAAAGTTCTTGATTGGCCGCGATGGAAAGGTCAAGGGACGGTGGGCTAGCACGAAGAAGCCCGAGGATCTGAAGGCGGATATTGAGAAGGAGATCAAGGCGGGAA
AGGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTCGAGCAGCGAGCACAGCCCCGCGACGCATCCTTGCGACGAGTTTGCGCATCAAACATAAACACCTGACACCACCTCTCACTACTCGACTTTGTGTAGCTATTGTAACTCCCACT
ACGCGAACGTATACACGGCTGCGACGAGCAACATACGCAACCATGTCTTCCGCAACTTCCTTCTTCGACTTTAAGCCCGCGGACA
AGAAGGGCCAACCCTACGACCTGGCCAAGCTGAAC
AACAAAGTCGTCCTCGTCGTCAACACAGCCTCCAAGTGCGGCTTCACACCGCAATTCGCCGGCCTCGAGAAGCTGTACAAGGACCTGAAGGCGCAATACCCGGATGACTTTGAGATACTC
GGATTCCCTTGCAACCAGTTTGGCGGACAGGATCCTGGAT
CAAACGACGAGATCCAATCCTTTTGCCAGGTCAACTACGGCGTGTCCTTCCCCGTGCTCGGCAAAGTGGACGTCAACGGC
GACAAGGCAGACCCGGCGTTTGAGTGGCTGAAGAACGAGAAGCCCGGGCTCATGGGGCTCAAGCGCGTCAAGTGGAACTTTGAAAAGTTCTTGATTGGCCGCGATGGAAAGGTCAAGGGA
CGGTGGGCTAGCACGAAGAAGCCCGAGGATCTGAAGGCGGATATTGAGAAGGAGATCAAGGCGGGAAAGGCTTAG

Retrieve as FASTA