Entry information : BtGPx02
Entry ID 5596
Creation 2007-07-25 (Christophe Dunand)
Last sequence changes 2015-12-15 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-15 (Christophe Dunand)
Peroxidase information: BtGPx02
Name BtGPx02
Class Animal glutathione peroxidase    [Orthogroup: Gpx1004]
Taxonomy Eukaryota Metazoa Chordata Mammalia Bovidae Bos
Organism Bos taurus    [TaxId: 9913 ]
Cellular localisation N/D
Tissue types Brain
Gastrointestinal tract
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BtGPx02
start..stop
S start..stop
CjaGPx02 383 1e-138 1..190 1..190
PtroGPx02 383 1e-138 1..190 1..190
HsGPx02 383 1e-138 1..190 1..190
HlGPx02 382 3e-138 1..190 1..190
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 33..254 222 N° 2 2820..3170 351  
join(33..254,2820..3170)


exon

Literature and cross-references BtGPx02
Literature Matukumalli,L.K. Construction and Analysis of a cDNA Library Generated From Intestinal Muscle and Epithelial Tissues of Holstein Cattle
DNA ref. GenBank:   AC_000167.1 (77384791..77381300)
Cluster/Prediction ref. GenBank:   XR_027766 UniGene:   Bt.29621
Protein sequence: BtGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   190
PWM (Da):   %s   21744.05  
PI (pH):   %s   7.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAYIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASL*GTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFTLVQKCDVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKFIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRTFQTINIEPDIKRLLKVAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron), 1 mRNA and 25 ESTs. Isolate="L1 Dominette 01449" and "Holstein".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTACATTGCCAAGTCCTTCTACGACCTCAGTGCTATCAGCCTGGATGGGGAGAAGGTAGATTTCAATACATTCCGAGGCAGGGCAGTGCTGATTGAGAACGTGGCCTCGCTTTGA
GGCACAACCACCCGGGACTTCACCCAACTCAACGAGCTGCAATGCCGCTTCCCCAGGCGTCTGGTGGTTCTTGGCTTCCCTTGCAATCAATTTGGACATCAG
GTGAGAGGTCCCTGGACT
TGGACTGCTGAAGCTCTAGAGGACTAAGGAGAGGGGGAGAATGACTGTGTGCTGGAGTGTCTGGAATTATGGGGTATGTTTTGTTAAGCAAGGTCTATAGGTACAGGTGAGTACCAGGGG
AAGTCAGTATGAGTCTGTCTGTGACAGCACACCAAAGATGTGGATTTCATGGTTTCTTGTCTTCCCACTACACTCACTCCATGAGGGTTGGTACCAGGTCTGGTTTTCTCTGCACTGTGT
CCTTGGTGCCTAGGGTATAGAAGACATTCATTAAATATTTGTTGAATGAATGATGGAGGAAACAGAAGATAAAGAATCAAATTAGGATTGAACTGACTCAGGAGACCGTTGTTCTCACTA
GACTTGATTCTGCTATTTAATGGGTCAGTGCCCACTCAATTTTTCTGTTTTGGTTTCCTCATCCATAAACTAGGGATAATACCACTTGTCTCATATAGGAGGGCTTCCCTGGTGGCTCGG
CAGTAAAGAATCTGCCTGAGTGTAGGAGACAAGGATTTGATCCCTGCGTCGGGAAGACCCCCTGGAAAAGGAAATGGCAACTCGTTCCAGTATTCTTGCCTGGGAAATCCCACGGACAGA
GAAGCCTGGTGGGCTACAGTCCATGGGGTCAGAAGAGCTGGGCACGAAGGATTATTGTGAGGTTGATAGTGTAAGAGCTACAAAAGTAACTTGGAAAATATAAATATGAAAAAGCAAGCA
ACTTTATTATTTAGATTGAAAGGTTTTGTTTGTTTGTTTGAAAGCAGCCAAGTGGACAGTGAATTTGGGGGAAGGCAAAGGGTTTATAAAGTGCGTGTGTTGCCTCTGGGTATCATATGC
TCCTCAATGTCCCTGATTAGTGGGTCAAGTTGTTACACATCTTTAGCCCACACACCTCAAGTTATCTTTTAGGGATTCTTCTATTTTCACTTAGGATTTTAATAGCACAAGCAGGCAGAA
TGTCCCTAAGTGAACCCTCCAATTATAATCTCTTTGGTTCAATTCACAGAGGCCTGAAGGCAAGGAAGAGACTGGCAGAGATACAGGCAGGAAGGCTGAAATGTCACTGGTTGTGACAGA
CCTGAGCCCAAACCATGACTGCTCTACTGTACCGTCCCCGTCTCAACTCCGTTTCTAGACGTGGCCAGGACGAGAGAGATACAAGAGGCAAAACCTCCTCACAGGTGCCTCCAGCCACCA
CTTCAGGCCAGCCAGTTGCTGAGGGAATTCATAATGTACCAGTAGCCAGCCAGCCATGTGCATTAGGAGATAAGACTTTAATAGCCATCAACTCTGGGCTCAAGATGTCATGACGGCCTG
GAACTGACTGTACTAATCGGTTCTAGTAGGTCAGAGGCGGGAACTTTTTCCCAGAGGGAGATACCGGACTCTTAGACTTGGGGGTGGGGGTGGAAAATAAGGGTTTCCATGGGCCTTTGA
GGGTTGTCAGGGGTGGAGAATCCTAAGCAGGGATAAGACAGGGCTGGCAGCAGGGAGAGAAGACAGGTAATGGGTTGAGAGCTAAAGCATTCTAGCTGAGGGTGAGGTCTAAGAGGAAGG
AACCATAATTACACATGCACAACTTTTGCCCTTCTTGCACTTATTTCCGTAACTTCCCCTTCCCCTGGCCTATTCCAGAAGCCTAAACCCTTTATCCTATTTAATTCATGCCTGGTGGCC
ATGAAGTAATTTCATATACAGTACATTCATTGTTGGTGCTAATCTATCTTATCTTTATATGGCACCTGAAAGCTAGTCTTCCTTGGATGGGGTTCTCCTTCATCAAAGTTTTCTCCTACT
TGTACTTCAGATCTAGGACGAGGCAAGATGAAAGGAAGAAGCTATAAATCCCATTCTTCTAGACTTCAATTTCACCTTTAGTTTGAGGAGCTGAGTAGGGCAGAGGCCGAGGCTATATTC
AACACTCACAGGTAATTAGAAGAGAGGCACAATCAGGGCAGAAGGAAAGGGAAGGTGGTGGCAGGCATGTGAGTGTGTGTGCATGCAGATGTGAGTGTGTGCAGGCTCTGTGTATGTGTG
TGTGTGCCTGCAGCTACATAAGTGGAAGAAGGGTTCTAGGCAGTGTGACCTGAGCCCCCTTTCCTTTTCTACTTCCCTGAGCTGAAGGTTCCTTGAAGATTCAGACATACCCTAAGAACT
GCTCAGGGTAGATCGAGAGAGAAGCAACAGCTCAAAAGCGCTAAATCTTCAGTACAAGAACAGCCAAACTAGGATCTTTGAGAACTTTCAGAAACAACAGCAAACCATCAGGACAATAGC
TCTGAGAGGGAAAACTCTGAGTCAATAGTAGGGCAAAACGAACGAAGAAGAGACAGAATAGGAAGGGGGATAGACTGCAGCCTACCAGGCTCCTCCACCCATGGGATTTTCCAGGCATGA
GTACTGAAGTGGGGTGCCACTGCCTTCTTCAGGAAGGGGGAAGATACCTAGAAAGAATGACCCTGTGGAGTACAGAAGAGTGAAAGGCTGTGTAGATTCTCCATCTTCCCCTTGCCTTTT
CCAAGCTTTGTCTCTTTGCTCCCCCAGGAGAACTGTCAGAATGAAGAGATCTTGAACAGCCTCAAGTACGTCCGCCCCGGGGGTGGGTTCCAGCCCACCTTCACCCTTGTCCAGAAGTGT
GATGTGAATGGTCAGAATGAGCATCCTGTCTTTGCCTACCTGAAGGATAAGCTCCCCTACCCTTATGATGACCCGTTTTCCCTCATGACCGATCCCAAGTTCATCATTTGGAGCCCCGTG
CGCCGCTCAGATGTGTCCTGGAACTTTGAGAAGTTCCTCATTGGGCCGGAAGGGGAGCCCTTCCGCCGCTACAGCCGCACCTTCCAAACCATCAACATCGAGCCTGACATCAAGCGCCTC
CTCAAAGTTGCCATATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTACATTGCCAAGTCCTTCTACGACCTCAGTGCTATCAGCCTGGATGGGGAGAAGGTAGATTTCAATACATTCCGAGGCAGGGCAGTGCTGATTGAGAACGTGGCCTCGCTTTGA
GGCACAACCACCCGGGACTTCACCCAACTCAACGAGCTGCAATGCCGCTTCCCCAGGCGTCTGGTGGTTCTTGGCTTCCCTTGCAATCAATTTGGACATCAG
GAGAACTGTCAGAATGAA
GAGATCTTGAACAGCCTCAAGTACGTCCGCCCCGGGGGTGGGTTCCAGCCCACCTTCACCCTTGTCCAGAAGTGTGATGTGAATGGTCAGAATGAGCATCCTGTCTTTGCCTACCTGAAG
GATAAGCTCCCCTACCCTTATGATGACCCGTTTTCCCTCATGACCGATCCCAAGTTCATCATTTGGAGCCCCGTGCGCCGCTCAGATGTGTCCTGGAACTTTGAGAAGTTCCTCATTGGG
CCGGAAGGGGAGCCCTTCCGCCGCTACAGCCGCACCTTCCAAACCATCAACATCGAGCCTGACATCAAGCGCCTCCTCAAAGTTGCCATATAG

Retrieve as FASTA