Entry information : GmPrx61 (Glyma14g05840.1)
Entry ID 560
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-10-10 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx61 (Glyma14g05840.1)
Name (synonym) GmPrx61 (Glyma14g05840.1)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Roots
Inducer Cyst nematode infection
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx61
start..stop
S start..stop
GmPrx80 644 0 1..326 1..324
PvPrx06 573 0 1..326 1..320
GmPrx328 552 0 1..326 1..320
GmPrx158 550 0 1..326 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4221160..4221390 231 N° 2 4220384..4220575 192 N° 3 4219766..4219931 166 N° 4 4219116..4219507 392
complement(join(4219116..4219507,4219766..4219931,4220384..4220575,4221160..4221 390))


exon

Literature and cross-references GmPrx61 (Glyma14g05840.1)
Literature Vodkin,L.et al, A Functional Genomics Program for Soybean. Alkharouf,N.W., Khan,R. and Matthews,B.F.Analysis of expressed sequence tags from roots of resistant soybean infected by the soybean cyst nematode.
DNA ref. Phytozome 12:   Gm14 (4221390..4219116)
Protein sequence: GmPrx61 (Glyma14g05840.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (298)
PWM (Da):   %s   35336.62 (32553.2)  
PI (pH):   %s   8.81 (8.94) Peptide Signal:   %s   cut: 29 range:29-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSCSSFMITLALLVLVLGTNTSSANANPTLHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKLGRRDSRTASQSAANNGIPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFRARIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPTFFDNHYFKNLIQKKGLIHSDQELFNGGSTDSLVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGTCTTGTTCTAGCTTTATGATCACTTTGGCCCTTTTGGTCCTCGTGTTGGGGACTAATACTAGTAGTGCCAATGCCAATCCAACACTTCACACAAACTTCTACTACAGTTCT
TGCCCAAAACTCTTTGACACTGTGAAACGCACAGTGGAATCGGCCATATCAAAGGAGACCCGCATGGGTGCTTCTCTCCTACGTTTGTTCTTCCACGATTGCTTTGTTAAT
GTGCGTAAT
TTTTTTTAACATTTCTTAATTAAACACTCTTCTTTCAATTCTATTTACTGCTAGAAGTTAACATTTTAAATTTTGCCTTCTTGTTTCTTTCCCAAACATTTTTTTACTTTACATTTGATT
TAAGTTATATATAATATGGGTTAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTGTTTGCTTAAATTATTTATTTATTTATTTTAAGAA
ACAAATCTTATCTATTTTCTAAAATAACACTTATTTTAAAATTATTTTTTTTAAGTTTAATCAAATTCACCTCTCTAACCAACTATTTTACATAAAAGCAAACTTTTGTAGCTAGTTTTT
GCAATTACATTTTGTACAACTCTTGTAATAAATTACTAAAGTAACCCCATTTATTTTTGTCACCATAGTTCATATCAATGGTGGTTATTCATGATCAGTGTAATTTATGTCCGATAGTAA
TTTTACTTTTGTTTGACTTTGTTGATACATATATATATATATAAAGAGACTAATAAATTTTCTAATTGGATAAATAAATATTATATATGTTGCAGGGGTGTGATGGGTCGATTCTACTTG
ATGACACATCAAGCTTCACCGGAGAGAAGAACGCGGGACCTAACAGGAATTCTGCCCGTGGATTTGAAGTGATCGACCAAATCAAATCAGCTGTGGAGAAAGTGTGTCCGGGTGTGGTTT
CTTGCGCTGACATTCTTGCCATCGCTGCCAGAGACTCTGTTGAGATC
GTAAGCAATTATTTATTTCAATGTCATTGCATATAGTTTAATACTTTAATCATGCATATATATGTATATATTA
TAAAAAAAGAGTATCGGCATGGCAATTATTTGTTGTATAAGGAAAGAAAAGAAAAATAATGCATAAAATGTTTAAGATATTCCTGATAAATAATTTTATATAAGACAAAGTATCCTTTTT
GAAAAGACATCCATTAACCTCGATCCTTAAAATTTTATTTTTCTATTTGTTTCTCTATCACTTGGAGAAAACAGATATTGTCATTTTCATTCTTTGCCTTTTCTTTTTCTTCCATTTTCA
CACCAATCTAAACAGAGGAAAATTTAGCTTGCGCGTTTCCTATGTACATGAATCAACAATCTCCACTTCTCCATTCTGCACACACATCAGAAACATATGCAAGCATACGTGAACTGAAAA
TTTTGTTGAATTTGATCAGCTTAGAGGCCCAACATGGGATGTGAAACTTGGAAGAAGAGACTCTAGGACGGCAAGCCAATCTGCTGCCAACAATGGCATCCCAAGACCCACTTCAAACCT
CAACCAACTTATATCCAGATTTAACACTCTCGGACTTTCCACCAAGGACTTGGTCGCACTATCTG
GTACTATTATAGAAGAGCCTAATATTATGCTCTCTAACACATTCATTTTAACATA
CTATAAACATGATTAAAAATTACAAAACGAGACTCCTTCAATTAGAAGTGGATTGAAAAGAGTAATTTAAAAATTGTGTTCATAACATTTCTCAAAATTAAAATGAGTTCCTCTTGGTAC
TTTTTTTATTAACTTGTTACCTTAGCAACAATCATTTACTCTCTTTTTTTATTATTTTAATTTCATTCCATTGCATATTCTAGGGGGTCATACAATTGGACAAGCAAGGTGCACAACCTT
TAGAGCCCGAATCTACAACGAGAGCAACATAGATAGCTCTTTTGCCCGCATGAGACAATCTAGGTGTCCCCGAACCTCAGGATCAGGGGACAACAACCTTGCACCCATTGACTTTGCCAC
TCCCACTTTCTTTGACAACCACTACTTCAAGAACCTCATTCAGAAGAAGGGTCTCATCCATTCCGACCAAGAACTCTTCAATGGTGGTTCCACTGACTCCTTAGTGCGTACCTACAGCAC
CAACCCGGCCTCCTTTTTCGCCGATTTCTCCGCCGCCATGATCAGGATGGGAGACATTAGTCCCCTCACTGGCTCCCGCGGAGAAATAAGGGAGAACTGCAGGAGGGTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGTCTTGTTCTAGCTTTATGATCACTTTGGCCCTTTTGGTCCTCGTGTTGGGGACTAATACTAGTAGTGCCAATGCCAATCCAACACTTCACACAAACTTCTACTACAGTTCT
TGCCCAAAACTCTTTGACACTGTGAAACGCACAGTGGAATCGGCCATATCAAAGGAGACCCGCATGGGTGCTTCTCTCCTACGTTTGTTCTTCCACGATTGCTTTGTTAAT
GGGTGTGAT
GGGTCGATTCTACTTGATGACACATCAAGCTTCACCGGAGAGAAGAACGCGGGACCTAACAGGAATTCTGCCCGTGGATTTGAAGTGATCGACCAAATCAAATCAGCTGTGGAGAAAGTG
TGTCCGGGTGTGGTTTCTTGCGCTGACATTCTTGCCATCGCTGCCAGAGACTCTGTTGAGATC
CTTAGAGGCCCAACATGGGATGTGAAACTTGGAAGAAGAGACTCTAGGACGGCAAGC
CAATCTGCTGCCAACAATGGCATCCCAAGACCCACTTCAAACCTCAACCAACTTATATCCAGATTTAACACTCTCGGACTTTCCACCAAGGACTTGGTCGCACTATCTG
GGGGTCATACA
ATTGGACAAGCAAGGTGCACAACCTTTAGAGCCCGAATCTACAACGAGAGCAACATAGATAGCTCTTTTGCCCGCATGAGACAATCTAGGTGTCCCCGAACCTCAGGATCAGGGGACAAC
AACCTTGCACCCATTGACTTTGCCACTCCCACTTTCTTTGACAACCACTACTTCAAGAACCTCATTCAGAAGAAGGGTCTCATCCATTCCGACCAAGAACTCTTCAATGGTGGTTCCACT
GACTCCTTAGTGCGTACCTACAGCACCAACCCGGCCTCCTTTTTCGCCGATTTCTCCGCCGCCATGATCAGGATGGGAGACATTAGTCCCCTCACTGGCTCCCGCGGAGAAATAAGGGAG
AACTGCAGGAGGGTCAACTAA

Retrieve as FASTA