Entry information : GmPrx64 (Glyma15g16710.1)
Entry ID 563
Creation 2005-11-09 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx64 (Glyma15g16710.1)
Name (synonym) GmPrx64 (Glyma15g16710.1)
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Roots
Roots hairs
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx64
start..stop
S start..stop
GmPrx181 613 0 1..342 1..345
MtPrx100 568 0 1..342 1..343
LjPrx50 543 0 16..342 16..350
PpePrx71 504 0 24..342 33..351
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13003199..13003310 112 N° 2 13003341..13003507 167 N° 3 13003994..13004336 343 N° 4 13004790..13005196 407
join(13003199..13003310,13003341..13003507,13003994..13004336,13004790..13005196 )


exon

Literature and cross-references GmPrx64 (Glyma15g16710.1)
Literature Public Soybean EST Project. Scheffler,et al, Expressed sequence tags from soybean root hair subtractive cDNA.
DNA ref. Phytozome 12:   Gm15 (13003199..13005196)
Cluster/Prediction ref. UniGene:   Gma.26620
Protein sequence: GmPrx64 (Glyma15g16710.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (321)
PWM (Da):   %s   38134.11 (35726.8)  
PI (pH):   %s   6.1 (6.10) Peptide Signal:   %s   cut: 22 range:22-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKNSSLPLLLLLVLYTISASSRPYENYDDKSSLSSTITLDETTFDNLLSFGYYRKTCPQFESILHNKVKEWIQKDYTLAASLMRLHFHDCSVRGCDGSILLKHDGSERTAQASKTLRGFEVVDDIKAELEKQCPKTVSCADILTAAARDATVELGGPYWAVPYGRRDGKVSIAKEADMVPMGHENVTSLIEFFQSRGMAVLDLVVLSGAHTIGRTSCGSIQYRLYNYQGTGKPDPTLDPKYVNFLQRKCRWASEYVDLDATTPKTFDNVYYINLEKKMGLLSTDQLLYSDARTSPLVSALAASHSVFEHQFAVSMGKLGIVDVLTGLEEGEIRTNCNFVNDY*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAAACTCTTCCCTCCCATTGCTTCTTCTTTTGGTACTTTACACAATTTCAGCCTCATCCCGACCTTATGAAAACTATGATGATAAGTCATCCCTTTCCTCCACAATAAGTGAAACT
GTCTTCTCTCTCCAAGTCCCAGCATTAGATGAAACCACCTTTGATAATCTCCTATCCTTTGGTTACTACCGTAAAACCTGTCCCCAATTCGAATCCATCCTACACAACAAAGTCAAAGAA
TGGATCCAGAAGGACTACACTTTAGCAGCTAGTCTCATGAGGCTCCACTTCCATGATTGCTCTGTCAGG
GTACATATTAAGCACTGTTCATCACTATGTGTCCATTTGCTTCATATTTTT
GTAGAATTATTTGTAAAAAAGAAATTAAAAAAAAAACTTGTGAATTTATATAAGAATAAACAATTCTTGTTAGTGATGGGTTATTATTTATATAAGGATCAATTTATATAAGAAATAATA
TCTTGACTATCCAAATGTGAGATTATAACTCTATTAAAAGTCATCAGTTAAATTTTTTGACTAAAATTAATTATCATCAGAATTGATAAATATTTTACAATAATTTAAATTTTTATCGGT
AATATTAATTTATTAATTTTTATTAAAAATATTAGTAGGACATTCAAACTTCCAAATTCTCTCTCCTCCCTTCCTCATTTTCCAACCACTTGACCAACCTACCTCCAATATTCTGCAACA
ATTAATGCCATGATAATTAAAAAATGTGGGTTATGATTTTGCACTATATTCATTTGGGCTATTCTATTTAAGCAGGGATGTGATGGGTCCATTCTGTTGAAGCATGATGGAAGTGAGAGG
ACAGCACAAGCTAGCAAGACACTGAGAGGGTTTGAAGTGGTGGATGATATAAAGGCAGAGTTAGAGAAACAATGCCCCAAGACGGTGTCTTGTGCTGATATTCTCACTGCTGCTGCAAGG
GATGCCACGGTTGAGTTAGGTGGGCCTTATTGGGCCGTTCCTTATGGTAGGAGAGATGGGAAGGTATCCATTGCTAAGGAAGCTGATATGGTGCCTATGGGCCATGAAAACGTTACTTCC
TTGATTGAGTTTTTCCAATCCAGGGGCATGGCTGTCCTTGACTTGGTTGTTCTCTCAG
GTAAATAAATTAAATGAAGCATTTATGAGTTGAATTTAATTACAATAGTCATCTAAAGTTTA
GTAAGATTATACAGCTTTATAATAAATATTTTTTAAATGTCATATCTAAAATGATTTTTAATGAATTGAAAATAAAATTGTATTAAAATTTAGAGTTTAATAATCATATAATAATATCAC
AAAACAATTTTATATTGTGAATGAATAAAAAATTATGTCTAAAAGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTAATAAGTTCAACTTTCATAGTTTGGATGCAAATGTGCAACATTATCCAACTTATTTCAAAATGTTTCACTAATTG
TTTGCTTTATATATGTGATGATTGTGTTCAGGGGCTCATACAATTGGAAGGACTTCATGTGGGTCCATTCAATACAGGCTCTACAACTACCAAGGAACAGGCAAACCAGATCCAACCCTA
GATCCTAAGTATGTTAACTTCTTGCAAAGGAAGTGTAGATGGGCCTCAGAGTATGTGGATCTTGATGCTACAACACCAAAGACCTTTGACAATGTTTACTACATTAATCTCGAAAAGAAA
ATGGGGTTGTTATCTACTGATCAGTTGTTATACTCTGATGCAAGGACTTCTCCCCTTGTTTCTGCATTGGCTGCCTCGCACTCAGTTTTTGAGCACCAGTTTGCTGTGTCAATGGGAAAG
CTTGGCATTGTTGATGTTCTCACTGGCCTGGAGGAAGGAGAAATCAGGACCAACTGCAATTTTGTCAATGATTATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAAACTCTTCCCTCCCATTGCTTCTTCTTTTGGTACTTTACACAATTTCAGCCTCATCCCGACCTTATGAAAACTATGATGATAAGTCATCCCTTTCCTCCACAATAACATTAGAT
GAAACCACCTTTGATAATCTCCTATCCTTTGGTTACTACCGTAAAACCTGTCCCCAATTCGAATCCATCCTACACAACAAAGTCAAAGAATGGATCCAGAAGGACTACACTTTAGCAGCT
AGTCTCATGAGGCTCCACTTCCATGATTGCTCTGTCAGG
GGATGTGATGGGTCCATTCTGTTGAAGCATGATGGAAGTGAGAGGACAGCACAAGCTAGCAAGACACTGAGAGGGTTTGAA
GTGGTGGATGATATAAAGGCAGAGTTAGAGAAACAATGCCCCAAGACGGTGTCTTGTGCTGATATTCTCACTGCTGCTGCAAGGGATGCCACGGTTGAGTTAGGTGGGCCTTATTGGGCC
GTTCCTTATGGTAGGAGAGATGGGAAGGTATCCATTGCTAAGGAAGCTGATATGGTGCCTATGGGCCATGAAAACGTTACTTCCTTGATTGAGTTTTTCCAATCCAGGGGCATGGCTGTC
CTTGACTTGGTTGTTCTCTCAG
GGGCTCATACAATTGGAAGGACTTCATGTGGGTCCATTCAATACAGGCTCTACAACTACCAAGGAACAGGCAAACCAGATCCAACCCTAGATCCTAAG
TATGTTAACTTCTTGCAAAGGAAGTGTAGATGGGCCTCAGAGTATGTGGATCTTGATGCTACAACACCAAAGACCTTTGACAATGTTTACTACATTAATCTCGAAAAGAAAATGGGGTTG
TTATCTACTGATCAGTTGTTATACTCTGATGCAAGGACTTCTCCCCTTGTTTCTGCATTGGCTGCCTCGCACTCAGTTTTTGAGCACCAGTTTGCTGTGTCAATGGGAAAGCTTGGCATT
GTTGATGTTCTCACTGGCCTGGAGGAAGGAGAAATCAGGACCAACTGCAATTTTGTCAATGATTATTGA

Retrieve as FASTA