Entry information : GmPrx[P]68
Entry ID 567
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-10-07 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx[P]68
Name GmPrx[P]68
Class Class III peroxidase     [Orthogroup: Prx020]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]68
start..stop
S start..stop
GmPrx59 367 5e-129 13..227 113..326
GmPrx59 76 2e-16 1..38 6..43
LjPrx70 328 7e-114 13..227 114..327
LjPrx70 54 0.000000006 1..61 7..62
CpapPrx22 293 7e-100 40..227 136..323
EguPrx68 270 4e-91 38..227 136..325
EguPrx68 45 0.000006 7..38 11..42
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19225956..19226067 112 N° 2 19225483..19225642 160 N° 3 19224460..19224937 478  
complement(join(19224460..19224937,19225483..19225642,19225956..19226067))


exon

Literature and cross-references GmPrx[P]68
Literature Vodkin,L.,et al, A Functional Genomics Program for Soybean.
DNA ref. Phytozome 12:   Gm14 (19226067..19224460)
Protein sequence: GmPrx[P]68
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   249 (231)
PWM (Da):   %s   28108.75 (26103.6)  
PI (pH):   %s   10.61 (10.70) Peptide Signal:   %s   cut: 19 range:19-249
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LIFHPNLFLLLLIVGCQAQLRIDYYRNTCPNVESIVRARGPSYAVELGRLDGRVSTKASVRHHLPHPEFKLERLNQMFASHGLTFTDLIALGGAHTIGFSRCNQSSKRIYNFKRRKSIDHTLNPAYAKQLKQVCPKNVDPRLAIDIDPVTPRTFDNQYYKNLQQGRGLLASDQALFTHKRTRDLVNLFASNNTAFEASFVSATTKLGRIGVKTGNQGEIRRDSTMVNRATIHVYVQILSNSSFNLFFFF

Retrieve as FASTA  
Remarks Allelic sequence of ID 558: No start codon (=>MCSH exist in another frame), FHDC, DAS and SCADIL are missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCATTTTCCATCCTAACTTGTTTCTTCTGCTGCTAATAGTTGGGTGTCAAGCTCAACTTCGAATTGATTACTACAGAAACACATGTCCAAATGTTGAATCAATTGTACGCGGTGTCAAG
CTCACACTTGTAGTCCAACATATAATTTTTAGTCATATAAAGGGGAGGAGGAGACCAAGGGCATTGAGGAAGTTGTTAAGAGAGATCTCAAGATAACTAATATATCTAAGGATTTGGTTT
TTGTTTTTGTTTTTGGAAGTATTAGTAAAATGTTAGGATCCCTGCATACTCCATAGAGTATCATATTTCTTTTGATTTGTCTTTATAAAATTGTTTTATTCTGGCTATGTGGAAAACTAT
ATGTAACATGTTAGTTCCTTGTACAATTTAGCTGAACACCAAATGAACATTCACTTGGTTTCAAGCAAGAGGACCATCTTATGCAGTAGAGTTGGGAAGGCTCGATGGGAGAGTCTCAAC
AAAAGCCAGTGTTAGACACCATCTACCTCATCCTGAATTCAAACTAGAACGACTGAACCAAATGTTTGCTTCACATGGCCTCACCTTTACGGATCTAATTGCTCT
ATAAGGTATTTCATC
CATAATGAACAAAATACATGTTTGATATCCAAGAGTTTAAGCTTGTTTTTGGATATACATTGGGATTGCTCAAACCTACATTTTGCAATAGGCAAGGTAGATTTAGCTAATTTTCAAATT
ATTTGGTTTTATGTTAGCAATCAAGTCTCCAAAATGCATTTTAACTCTCAAATCAATTATGAAAAGAAGCAAGTCTTGTGTAAGTTATTCATTAGGTTGGAAAAATTATACTTTTTATGA
AAATAATCACTTCACTTGAAACTTACTTTTAACCGGAATCAATGGAATCAATTTTACAAAATCAAGATACTCCAAATCAACTTTATAAATGCCTATTTGAACACACTCATAGAGACATAA
GTCCTATTTGGACAAATTTCTCAATAAACACTTCTAAGAAAAGAAAAGAAGATAAAATGAAGTTTTTCTCACAAGTTAAATGAGAAAACTTCTATAAATTAACTTATGCATCCAACAAAA
TGTGTTTCTTATTGGAATCTAAATTAGAGAACTTCTATAAATCTGATTACAGGAGGAGCACATACTATTGGGTTCTCTCGCTGCAACCAGTCCTCCAAACGGATTTACAACTTCAAAAGA
AGGAAAAGCATTGATCACACACTGAATCCTGCGTATGCAAAACAGCTCAAGCAAGTGTGTCCAAAAAATGTGGACCCCAGATTAGCCATTGACATTGACCCAGTTACACCTAGGACATTT
GATAACCAATACTACAAGAATCTTCAGCAAGGAAGAGGACTCCTTGCTTCTGATCAAGCTTTGTTTACTCACAAAAGAACAAGAGACCTAGTGAACTTGTTTGCATCCAATAACACAGCC
TTTGAAGCTTCTTTTGTAAGTGCCACGACGAAGCTTGGACGGATTGGGGTCAAAACGGGCAACCAAGGTGAAATCAGGCGTGATTCCACAATGGTTAACCGAGCTACTATCCATGTTTAT
GTTCAGATATTGTCAAATTCTTCTTTCAATCTTTTCTTCTTCTTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCATTTTCCATCCTAACTTGTTTCTTCTGCTGCTAATAGTTGGGTGTCAAGCTCAACTTCGAATTGATTACTACAGAAACACATGTCCAAATGTTGAATCAATTGTACGCGCAAGAGGA
CCATCTTATGCAGTAGAGTTGGGAAGGCTCGATGGGAGAGTCTCAACAAAAGCCAGTGTTAGACACCATCTACCTCATCCTGAATTCAAACTAGAACGACTGAACCAAATGTTTGCTTCA
CATGGCCTCACCTTTACGGATCTAATTGCTCT
AGGAGGAGCACATACTATTGGGTTCTCTCGCTGCAACCAGTCCTCCAAACGGATTTACAACTTCAAAAGAAGGAAAAGCATTGATCAC
ACACTGAATCCTGCGTATGCAAAACAGCTCAAGCAAGTGTGTCCAAAAAATGTGGACCCCAGATTAGCCATTGACATTGACCCAGTTACACCTAGGACATTTGATAACCAATACTACAAG
AATCTTCAGCAAGGAAGAGGACTCCTTGCTTCTGATCAAGCTTTGTTTACTCACAAAAGAACAAGAGACCTAGTGAACTTGTTTGCATCCAATAACACAGCCTTTGAAGCTTCTTTTGTA
AGTGCCACGACGAAGCTTGGACGGATTGGGGTCAAAACGGGCAACCAAGGTGAAATCAGGCGTGATTCCACAATGGTTAACCGAGCTACTATCCATGTTTATGTTCAGATATTGTCAAAT
TCTTCTTTCAATCTTTTCTTCTTCTTTTGA

Retrieve as FASTA