Entry information : MtGPx01 (Medtr1g014210.1[4.0] / MtGPx01)
Entry ID 5696
Creation 2007-08-13 (Christophe Dunand)
Last sequence changes 2007-08-13 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-07-31 (Messaoudi)
Peroxidase information: MtGPx01 (Medtr1g014210.1[4.0] / MtGPx01)
Name (synonym) MtGPx01 (Medtr1g014210.1[4.0] / MtGPx01)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Flowers
Leaves
Roots
Stems
Whole plant
Inducers Colletotrichum inoculation
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value MtGPx01
start..stop
S start..stop
MsGPx01 460 1e-167 2..235 1..234
PsGPx01 421 5e-152 1..236 1..236
LjGPx01 354 7e-126 1..227 1..226
CsGPx01 334 1e-117 3..236 5..245
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3070320..3070574 255 N° 2 3069546..3069622 77 N° 3 3069094..3069155 62 N° 4 3068013..3068131 119
N° 5 3067766..3067933 168 N° 6 3066687..3066716 30  
complement(join(3066687..3066716,3067766..3067933,3068013..3068131,3069094..3069 155,3069546..3069622,3070320..3070574))


exon

Literature and cross-references MtGPx01 (Medtr1g014210.1[4.0] / MtGPx01)
Literature Shaull S., Lin S., Dixon R., May G., Sumner L., Gonzales B., Cook D., Kim D., Roe B.A.; Submitted (MAR-2006) to the EMBL/GenBank/DDBJ databases.
Protein ref. GenPept:   ABE93916 UniProtKB_Uniparc:   Q1SI06
DNA ref. GenBank:   AC143339.12 (78645..82824) Phytozome 11:   chr1 (3070574..3066687)
Cluster/Prediction ref. Phytozome Gene 11:   31100806 UniGene:   Mtr.9195
Protein sequence: MtGPx01 (Medtr1g014210.1[4.0] / MtGPx01)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   236
PWM (Da):   %s   26379.53  
PI (pH):   %s   9.84
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSMASSTTFFTPLHNFNQARTNSIPSISLPFVKSSIPSSKSPFFQHGFSQPTSFDFPKAVLKSRSFSVNARAVTDKSIYDFTVKDIDKKDVPLSKFKGKVLLIVNVASRCGLTSSNYTELSHLYENFKDGLEVLAFPCNQFGMQEPGSNEEIKKFACTRFKAEFPIFDVDVNGPFTAPVYQFLKSSSGGFFGDLVKWNFEKFLVDKNGKVVERYPPTTSPFQIEKDIQKLLAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 5 introns) and 22 ESTs. Cultivar="A17".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTCCATGGCTTCTTCCACAACATTCTTCACACCTCTTCACAATTTCAATCAAGCTAGAACAAATTCAATACCTTCAATTTCTTTGCCTTTTGTAAAATCCTCAATTCCTTCTTCA
AAGTCACCTTTTTTTCAACATGGCTTTTCTCAACCAACTTCTTTCGATTTTCCTAAGGCTGTTTTGAAGTCAAGGTCTTTCTCTGTCAACGCTAGAGCTGTTACTGATAAATCCATTTAT
GATTTTACTGTAAAG
GTATCATTTTTAATTTTCAATTTTAATGTTGTGTTAGAATTGAGTAGATTTTTTTTTTTTTTTTTTTTGTGTGGTTTTTGTTGTGATAATTTGTTAAGGGTTTAT
CATGATAAGTGTTAATGGATAAGTTTTTTATATAACGGAAGATAAAATAAAGTTAATTGTTGTTTTCATAAGCTATTTGGGAGAACTTATAATAATTAAGCTGAAAACAGCTTATGAACA
TGTCATAAGTTGTTTATTATGATAGGTTTTATGGATAAGCTGTTTATATAACGGAAGATAAAATGAAGTTAAATTGTTTTTCGTATATGCTATAAGCTGTTTTCGTAAGCTATCTTGGAG
AACAGGGCCCGTTTGGATTGGCTATTTTTTTTTTTTAGCTTATACAAATAAGTAAGCTTTAATGTATTATTCATAAGCTTGTCAAGGTAGTTTATGAAAAAACAGCTTATGAAGATACAA
TTTTCACTAGTGAGAACTTATGAATTAACATAAAAGCTTATTTATTGTCATAAGCTGTTTTCGTGAATTCTCCCAGACAGTCTCACAATGTTTATGCTAGTAGATGAGTGCAGATAAGCC
AATCGAAACAGGCATATAGTTTTGTTTAACGGAGGAACCCTTTTTTGGAATTGAAGAAAAAAATGTTAATTTATTTGTTATAAGATGATCATACTATTATTATGTGGTGCAGGATATTGA
TAAGAAGGATGTGCCTCTTAGCAAATTCAAGGGGAAGGTTCTTTTGATTGTTAATGTTGCTTCAAGATG
GTATGTATTATTATTCACTTTATATTTGTGGTCGGCCCTTTTTTTTTCAAT
TGTAATGTTCGGGAGGGATTTGCAATTTAGAACCATCACTTTCTCACTCCTCTAATGTAAGACATCAAATTCCCCTTAGTTACACACACCTCTAGTTTGTTATACAAAAATAGAGTCGGT
GACTTTGTGTGTGACTTGATGAGAGCATGAATTTGGTGTCACTTATCCAACAAGTTAGAGTGGTGAGTCTTCATTCAAGTATGCTCTATTTAAGCATACTTGAGGAGAGATAAGTCAGTT
TCTCCTGCTATTTGAAAAGGTCTAATCAAATAACTTGAAAGTTATGTCAAAGTTTATGGTGAGTTACGTTTCTATTGAATGGTTTCCTTTGAATGGCAGCGGTTTGACATCATCAAACTA
CACGGAACTCTCACACTTATATGAAAATTTTAAAGACAAAG
GTACGTTACTTATGGATCATAGTTATTTGTTTATATTTCTTATATTTTTTATTTTGACTATTGGTCACTACCTGTTATC
TGGATCTTGTACCCTTCCTTCCTATCGAAACATTTCTCTATAGGCTAAACATATCTTTATATGGAAAGCTATTGGTTATGCTTGTAAAGCACATGTCCATTTTAACCAACGGGGTTGAGT
CTAGCAGATGTGCTAGTCCCCCCAATTGACAAACACATTTTGAATCTTCACTGGAAGAGATGCTCGTATTAGTGTCTAATCGTGTCTCAAATAGGATTGGCTTCTGTATAAGGATATCCT
GGGGAAACCTCAAATAAAAAATGCATGTGTTTTCGTGGGTAATGCTATATGCAATTTATACAGACTACCTATCTTGCTTTATTTCCACCATTTGCAATTTAGGATATTAACTTGTCTGAC
ACTAGTATTGTTATTCTCATTCCCCTGCTTTCTGTTTGGCATTTAACGGTGTTTGTTGTGGAGATGGAAAACATAAAAGTGAAAAATTAGGCAGGGGGTAAAGTGAACTAATGAAGAAGA
TGGAAAACTTTTCATTTTACCTTGTTTTGTTTTGTAATTTGGGGCTGAGAAGCTATTTGTTTGCAGCTTTCTGAGAGCTTTTTAATAGGAAAACAATTTCCCCCCTAAAAGTAACTGAAC
AAAAATGTGCATAGTTGCATTCTGATTACAATTTTGGTGTTGAAGAATTTGCTAAAGGATAGATAGACTAATGTAAGGAGCATATCAGGGTCACTATATGGTGGAACATGAGTGAGCTCT
TGCTGGAAAATTAAATTTTTTCCAAATGATAGATTCAAAAGTGACTGAAATTTGATTTTCTACTTTGTTGTTTCTCTTTGAACACGGCTTTCAGATTTTTAGTTCAAAAAACATTTTTGT
ACGAGCCACACATTTTTATTGTCCTTGTGCATTTTCTTTCCAGGTTTGGAGGTTCTAGCTTTCCCTTGCAATCAATTTGGCATGCAGGAGCCTGGATCAAATGAAGAAATTAAGAAATTC
GCTTGCACTAGGTTCAAAGCAGAATTTCCAATTTTCGATAAG
GTTCGATAATGTTTCTTTATCTAGTAGTTCAGAATAGATTACATGTGAGTAAACCAAGTACTGAAGTTTTGTAAAACA
GGTTGATGTAAATGGACCATTTACTGCTCCAGTATACCAGTTTCTGAAGTCAAGTTCTGGAGGGTTTTTTGGTGATCTTGTCAAGTGGAATTTTGAGAAATTCTTGGTTGATAAAAATGG
TAAAGTTGTTGAACGATACCCACCAACAACCTCTCCTTTTCAAATTGAG
GTATGTTAAACTTTCCAACAGCATCAAAAGTCTAGCTTCTAATTTTTACGGTGGCAATGAATTATTAACTA
GTTAGGTACCTCCTCAAGTATGTCAATGTGATTTTCCGGACAAAATTGAAGATGAGAGTAATACATCTTTAGTGGTGTTTTAAGCTAAAAGAAAATGTTCAGAAAACTGTCTTTGAGCTG
ATTTTAAGCTGTATTTGATTATATCGGAAAATTTAGCTCTGAAGATTCACTATCGAAATTTTGTGCTGAAAATTCTGACGCTAAAATTAAGTGTTTAAAATTCTCTCATTTAAATTCAAG
TAGTTTCTCACTCACGTAAATTTTTAGTACATATAAAACAAATATATAGTATTATTTTCAGCACAGCTGAATTTTGAAATTAGCCCTATATATGATAGTCAAGACAACAAGTTATTTAAT
AAAGTTACACTGATTAATACCTCTGCCACTCATATGTATCATAAATGAAGCTTTTACTGGCAAGGGACAAACAATTGAGGCTTTAGTGAAGAAGAAAATGAGTTGTTCTTAGGTACTAAC
AAATTGTTGATATGGCGTATAGTTTCTTATTTGAATAACTTGGTATGGTATGTATGATATGGTATCATTGTATGTCAGTATGTGAGAGTAAGGATAATAGTATGTATGACTAAGGTTGAC
TTTAAGAGTTGACTTGAACATAACACTTATATGATAAACACTTAGTTAAGCAGTTTGCCTGTTTTCACTAAACTTAATTAATTAAGGGCTTCAGCATACCAGTTTTCACTCTACCAGAGT
CTGATGTAAATTGCCATTGATTTGTTGAGTTGGTTATACTCTACCAAAGCCAACAATATCACCAGATCAAGCTTCCACATTGGATTTCTTTTTGCAATTACAAGAAACTATATTGGTTCA
TAAATAATATAAGGGGATTTCTTATTGCAATAACAAGAAACTATAATGATAATGTATCCACGATTAATATCCGTATACTATGGACTTCCTAAAACATTTTATGCTTAATCTGATCTACCC
CGTTTCACATCTTTGCAGAAGGATATCCAGAAGTTACTTGCTGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTCCATGGCTTCTTCCACAACATTCTTCACACCTCTTCACAATTTCAATCAAGCTAGAACAAATTCAATACCTTCAATTTCTTTGCCTTTTGTAAAATCCTCAATTCCTTCTTCA
AAGTCACCTTTTTTTCAACATGGCTTTTCTCAACCAACTTCTTTCGATTTTCCTAAGGCTGTTTTGAAGTCAAGGTCTTTCTCTGTCAACGCTAGAGCTGTTACTGATAAATCCATTTAT
GATTTTACTGTAAAG
GATATTGATAAGAAGGATGTGCCTCTTAGCAAATTCAAGGGGAAGGTTCTTTTGATTGTTAATGTTGCTTCAAGATGCGGTTTGACATCATCAAACTACACGGAA
CTCTCACACTTATATGAAAATTTTAAAGACAAAG
GTTTGGAGGTTCTAGCTTTCCCTTGCAATCAATTTGGCATGCAGGAGCCTGGATCAAATGAAGAAATTAAGAAATTCGCTTGCACT
AGGTTCAAAGCAGAATTTCCAATTTTCGATAAG
GTTGATGTAAATGGACCATTTACTGCTCCAGTATACCAGTTTCTGAAGTCAAGTTCTGGAGGGTTTTTTGGTGATCTTGTCAAGTGG
AATTTTGAGAAATTCTTGGTTGATAAAAATGGTAAAGTTGTTGAACGATACCCACCAACAACCTCTCCTTTTCAAATTGAG
AAGGATATCCAGAAGTTACTTGCTGCGTGA

Retrieve as FASTA