Entry information : MtGPx08 (Medtr8g098400.1[4.0])
Entry ID 5698
Creation 2007-08-13 (Christophe Dunand)
Last sequence changes 2007-08-13 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-20 (Catherine Mathe)
Peroxidase information: MtGPx08 (Medtr8g098400.1[4.0])
Name (synonym) MtGPx08 (Medtr8g098400.1[4.0])
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Roots
Inducers Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value MtGPx08
start..stop
S start..stop
PvGPx08 296 5e-105 1..171 1..169
LeGPx08 289 6e-102 1..169 1..167
StGPx08 287 4e-101 1..169 1..167
NtGPx08-1A 286 6e-101 7..171 5..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 40892274..40892333 60 N° 2 40892469..40892545 77 N° 3 40892782..40892843 62 N° 4 40892965..40893083 119
N° 5 40893578..40893745 168 N° 6 40893862..40893894 33  
join(40892274..40892333,40892469..40892545,40892782..40892843,40892965..40893083 ,40893578..40893745,40893862..40893894)


exon

Literature and cross-references MtGPx08 (Medtr8g098400.1[4.0])
Literature REFERENCE 1: Lin S., Dixon R., May G., Sumner L., Gonzales B., Cook D., Kim D., Roe B.A.; Submitted (MAR-2006) to the EMBL/GenBank/DDBJ databases.
REFERENCE 2.: Bird,D., Koltai,H., Samac,D., Town,C.D., Van Aken,S., Utterback,T., Cheung,F., Tsai,J. and Fraser,C.M. ESTs from roots of Medicago truncatula after infection with the nematode Meloidogyne incognita.
Protein ref. GenPept:   ABE92132 UniProtKB_Uniparc:   Q1RY58
DNA ref. GenBank:   AC151526.19 (90476..92270) Phytozome 11:   chr8 (40892274..40893894)
EST ref. GenBank:   BM814275
Cluster/Prediction ref. Phytozome Gene 11:   31074163
Protein sequence: MtGPx08 (Medtr8g098400.1[4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172
PWM (Da):   %s   19207.59  
PI (pH):   %s   4.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTEPSNSKDPKSVYDFTLKDGMGNDVDLATYKGKVLLIVNVASKCGMTNSNYVGLNQLYDKYKLGLEILAFPSNQFGEEEPGTNDQILDFVCTHFKSEFPIFDIEVNGDNSAPLYKFLKSGKWGIFGDDIQWNFAKFLVDKDGQVVDRYYPTTSPLSLERDICKLLGVE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 5 introns) and 2 ESTs (BM814275 and BF634130). Cultivar="A17".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCACCGAACCCAGTAACAGTAAGGATCCAAAATCGGTCTACGACTTCACTCTCAAGGTTGTTATCTATCTCTTTCATTTCACTTCCTTCTTCTTATCTCTGTCTGTGCGCTTTCAC
TTAACTACCACTGTTTTGTTCATTTATATATTTAAAACATTTTTTTTTTTGTTTTCTTCAATTCCAATTCTGCAGGATGGTATGGGAAATGATGTTGATCTCGCCACTTACAAGGGTAAA
GTCCTCCTCATTGTTAATGTTGCTTCCAAATG
GTATGTATATCCGACCATACTCTCTTTTATTAAACGCACTTGTAAAATCACATGTTCATAAGCTCTTTTCAACTTATTCCTATAAGCC
CTCCTCGATTGTTTATGAAAATAGCTTATAGAATATACAAAAACTGGCCATAGAATTAACTTATCTGTAAGCCCTTATGCTATAAGCTACTAAGTAAGCTGTTTATTTGTAACTCATGTT
TGTTTTTGGATTGATTTCATCGAGTCAGTGGTATGACCAACTCAAATTATGTGGGGTTAAATCAACTATATGACAAGTACAAACTCAAAGGTTTGTATTTCTATTTCTTTTGGGGATCAC
AGTGTTTCTTTCTTTCTATTGTTGTTTTCCAAATATTATATGTTTATGTTATACACATGAGATGAGATGACTGAATTGGTATCTTAATTAGGCCTTGAGATTCTGGCATTTCCAAGTAAT
CAATTTGGTGAGGAAGAACCTGGAACCAATGATCAAATATTGGATTTTGTTTGTACTCACTTCAAATCAGAATTCCCCATCTTTGATAAG
GTAATTCAACATATAATCTTCAAATTGGAA
ACCCTAGTTTTCTTGACTTGTTCTCTTCCAAGTTCCTATTTTGTAGACGGTGAAGATTAAATAATTGAGATTTTGTGCCTCTGCACTATGTTTGCTTGCTGCTTGTTTCAATTATGTGTT
TGCAGTGGTATGATTTACACTTTGCATTGTTACCTATTGTCAATCCTAAGCCTTTCCGTGTATATGATGATTTAAAACAAGTTAACACAAAATAGCACCAATAGTAATTATTGATCTTCA
TGCGATTTATAATTTACACCAAAATTTGCGATATATATTTAAAGATAATTCCACTGCTACTGTGAACCGTAATGATCTTCAATTGTTGCTTGACTAGTTGTACTTAGTTGGATAAAGATA
ATAAGATTACTGCTATTCTGCATAGACTTCTGCTAAATACTTTGCATTGAGGAACTGATATCGATATGCACAAACTTTTAAGTTCATCTCCATGGTTGTGCTAGATTGAAGTGAATGGGG
ACAATTCTGCTCCCTTGTATAAATTCTTAAAGTCGGGTAAATGGGGAATTTTTGGGGATGATATTCAGTGGAACTTTGCCAAGTTTCTAGTTGACAAGGATGGTCAAGTGGTGGATCGAT
ATTATCCCACCACGTCTCCTCTTAGCCTTGAG
GTACACGGAGCGTTATTATTCAAGAAATTCATATTTTTTATATATATCAATATCAATTGATATGGATGGTTTATGTTGCTTATGTAAT
TCTTCGGGTGTCTTTTCTTGTATTGCAGCGAGATATCTGTAAACTACTTGGTGTTGAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCACCGAACCCAGTAACAGTAAGGATCCAAAATCGGTCTACGACTTCACTCTCAAGGATGGTATGGGAAATGATGTTGATCTCGCCACTTACAAGGGTAAAGTCCTCCTCATTGTT
AATGTTGCTTCCAAATG
TGGTATGACCAACTCAAATTATGTGGGGTTAAATCAACTATATGACAAGTACAAACTCAAAGGCCTTGAGATTCTGGCATTTCCAAGTAATCAATTTGGTGAG
GAAGAACCTGGAACCAATGATCAAATATTGGATTTTGTTTGTACTCACTTCAAATCAGAATTCCCCATCTTTGATAAG
ATTGAAGTGAATGGGGACAATTCTGCTCCCTTGTATAAATTC
TTAAAGTCGGGTAAATGGGGAATTTTTGGGGATGATATTCAGTGGAACTTTGCCAAGTTTCTAGTTGACAAGGATGGTCAAGTGGTGGATCGATATTATCCCACCACGTCTCCTCTTAGC
CTTGAG
CGAGATATCTGTAAACTACTTGGTGTTGAATGA

Retrieve as FASTA