Entry information : MtGPx02 ( Medtr8g105630.1[4.0])
Entry ID 5699
Creation 2007-08-13 (Christophe Dunand)
Last sequence changes 2016-04-06 (Catherine Mathe)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-04-06 (Catherine Mathe)
Peroxidase information: MtGPx02 ( Medtr8g105630.1[4.0])
Name (synonym) MtGPx02 ( Medtr8g105630.1[4.0])
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Roots
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtGPx02
start..stop
S start..stop
CarGPx02 317 1e-112 32..198 1..167
EglGPx01 307 4e-108 7..198 8..202
LjGPx02 305 8e-108 32..198 1..167
EguGPx01 306 9e-108 7..198 8..202
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 44557362..44557499 138 N° 2 44557073..44557149 77 N° 3 44555750..44555811 62 N° 4 44555526..44555644 119
N° 5 44555087..44555254 168 N° 6 44554960..44554992 33  
complement(join(44554960..44554992,44555087..44555254,44555526..44555644,4455575 0..44555811,44557073..44557149,44557362..44557499))


exon

Literature and cross-references MtGPx02 ( Medtr8g105630.1[4.0])
Literature Cheung,F., Moskal,W., Cooper,J.D., Xiao,Y., May,G.D. and Town,C.D. Construction and analysis of normalized cDNA library from flowers, seeds and stems of Medicago truncatula.
Protein ref. UniProtKB:   G7LBF8 [Incorrect prediction]
DNA ref. GenBank:   AC202355.7 (29133..32574) Phytozome 11:   chr8 (44557499..44554960)
Cluster/Prediction ref. Phytozome Gene 11:   31073439 [Incorrect prediction] UniGene:   Mtr.16911   Mtr.5760
Protein sequence: MtGPx02 ( Medtr8g105630.1[4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   199
PWM (Da):   %s   22755.73 Transmb domain:   %s   o5-24i
PI (pH):   %s   9.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDTQLLTFWNFLSFFLLLIALYFFRRNSSSKMAENSSKSIYDFTVKDISGNDVSLSQYRGKVLLVVNVASQCGLTQTNYKELNVLYQKYKDDFEILAFPCNQFRGQEPGSSEEIQNVVCTRFKAEFPVFDVEVNGKNAEPLYKFLKDQKGGIFGDGIKWNFTKFLVNKEGKVVDRYAPTTAPLKIEKDIEKLLRSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 4 introns) and 16 + 19 ESTs (two independant unigenes!!!). Cultivar="A17".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACACACAGTTGTTGACTTTCTGGAACTTCTTATCGTTCTTTCTTCTTCTTATAGCTTTATACTTCTTCCGCAGAAACTCATCTTCCAAAATGGCAGAAAATTCATCCAAATCCATC
TACGATTTCACTGTCAAG
GTTCCATTTTTTCATACCCAGTTCTGTTTATTTATTTATTTATTTATTTTTTATGTTTTTTCAATCTAATTATTTTTTAAAAAATTTGTTTTTTGATCATGC
CCAATTTTTTTTTGCACTCAAATCTGTTGATGGGTCAATGGAAAAATTTCAAATTGATTGATTTTACTTTTCTGATTTAATTTTGTTTGTGATATGTACTACAATTACAGGATATCAGTG
GAAATGATGTGAGTCTGAGTCAATACAGAGGGAAGGTTCTGCTGGTTGTCAATGTTGCCTCCCAATG
GTAACTTAATTATATTCATTTTTTGGTTATTGTTTATAGCTACTGTATAGAAA
TTTACCTGATCTACATATTTTAATTTATTTATTTTAAATACATATAGTGTGTTGTGCTCATTTCAATCTTTTTTTGGTCTGTTAATCACTGTCCAGTCCTTTATGATTTAATTCATATAC
ACCATTTGTTCATATATATATTTTTTTCACCATCAATCAATTATGATCTGTCCTTCAATAGGCCAGGCCGGCCTACAGGGGCCTATGGCCTAGCCTATTAAGGCCTGGCCTATTTAAGTT
GAAAAGTCGCACATATAATTGATTGTGATTTTTTGGCAGTTTAAAACTTTTTACGTTGAGTGTATCCAAATTAAGCTTTGTGCTTTATATTACTCTTGCTTTGTGCAAAAACAAAGATAG
AATTGCGAAGTATAGCTGGCACCTATGGATTATGTTGTGTGATTTGCAGTGAAACAAGTTTATCTATTTTAGTGTTTGATGTTTGAGAAATGTCATGGAGTTATTCTGTATAATATGATA
CTAGAATTTCATTATCACCAAACAAGAATACTTGCACAGTTTTTATTCATTAATCTTTCTCCATTAGTAGGTGATCTGTTATTTTGTTCAGATTCTAAATAAAAGAACACAGATTTTCAT
TCTGAAGTTAATGGTAATGTAGTACAAGAAACTTGATGTGAGATTTAAATCAATGGTGGTTACATCCTCTTGACTGTTTGGGTGCATAGAGGTTTGTTGTTTTTTGTTCTGTTTTTGTTG
ATTGGTTTGGAGGTGCGCGTATTTTATGCTGTTTTGTTTTTGGTGGCACGTGTTTTTTGCGTTGTTTTGTTCTTGGCCCCTTCGTGGGTAATTGTTTTGTATTTTTGTTTTGTTTTTGGC
ACACCTTCGGCTTAGAAAAAGTTATTAATGAAATTTTGTGGCTTCTTCAAAAAACAATTGGGGGTGAGATTGGACTATCATATGCGGGTTTAATGTGAATTAATCTGACACTGTAATGCC
TTAGGATCTAAGCCAAAGCAACAACTTCTTTGTTGGATGATGCTAGACAAACTTTCAGTTTCTTATTAATAGAAACTACAGCTAAAGATAGCTCAATCTATTATTACATTAAAAATGTCA
AATTTTGTGTGCATGTTTCCCTGACCATGATTTCATGCACAATTATAGGAAATTATTCTTCTCCATTTTATTCTGTCTATAACTATTAACTATAACTATAATTGTAATATTCTAATTCAT
TGTTGCAGCGGTTTGACACAAACAAATTACAAAGAGTTGAATGTTCTGTACCAGAAGTACAAGGATCAAGGTCCGTGACTTTAACCAAGGACAAAAACAAAAAAATACATGTCAACTATA
ATTTATGAGTGTTAATTGTGTAATACTGATACTTGTGATTGTGAATTGTCTCTAGACTTTGAAATCTTGGCATTTCCATGCAACCAATTTCGTGGACAGGAGCCAGGATCTAGTGAAGAA
ATTCAAAATGTTGTTTGCACAAGGTTCAAAGCTGAATTCCCAGTCTTTGATAAG
GTGATTACCGTGATTTATTGTAAATTCTTTGTAACTTATTTGACATTTGACACACTATGCATGGTT
ATTGTAAATTCTTTGTAACTTATTTGACATTTGACACACTATGCATGGAGATGGTCTTGTTTGGACTCTCGATGTACTTGGCAATTTCCCTAGCCAAATTTTATATGCTCTTTTTTTTTG
CAATGAATTCTGCAAGGATACAACACAATATTAATATATATGCCAGTTTATATGAAAATCATTTTAATATATCAAATTATTATAGGTTGAAGTCAATGGGAAGAATGCAGAACCACTTTA
CAAGTTTTTGAAGGATCAGAAAGGAGGAATATTTGGAGATGGTATCAAGTGGAACTTCACAAAGTTCTTAGTAAACAAAGAAGGGAAGGTTGTGGATAGATATGCTCCTACCACCGCTCC
TCTGAAAATCGAG
GTTAGAAACATTTTAGTGCTTATATTTTAGGCCAGGTTTCTATGTACGTTGTGCTGCGATTACATGTCACTGAGTTATATGTTTCTTCTTGCAGAAGGACATCGAGA
AGCTTTTACGGTCTTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACACACAGTTGTTGACTTTCTGGAACTTCTTATCGTTCTTTCTTCTTCTTATAGCTTTATACTTCTTCCGCAGAAACTCATCTTCCAAAATGGCAGAAAATTCATCCAAATCCATC
TACGATTTCACTGTCAAG
GATATCAGTGGAAATGATGTGAGTCTGAGTCAATACAGAGGGAAGGTTCTGCTGGTTGTCAATGTTGCCTCCCAATGCGGTTTGACACAAACAAATTACAAA
GAGTTGAATGTTCTGTACCAGAAGTACAAGGATCAAG
ACTTTGAAATCTTGGCATTTCCATGCAACCAATTTCGTGGACAGGAGCCAGGATCTAGTGAAGAAATTCAAAATGTTGTTTGC
ACAAGGTTCAAAGCTGAATTCCCAGTCTTTGATAAG
GTTGAAGTCAATGGGAAGAATGCAGAACCACTTTACAAGTTTTTGAAGGATCAGAAAGGAGGAATATTTGGAGATGGTATCAAG
TGGAACTTCACAAAGTTCTTAGTAAACAAAGAAGGGAAGGTTGTGGATAGATATGCTCCTACCACCGCTCCTCTGAAAATCGAG
AAGGACATCGAGAAGCTTTTACGGTCTTCTTAA

Retrieve as FASTA