Entry information : AruPrx02 (PrxC2 / PeroxidaseC2 / HRAPRXC2 / HRP_04627)
Entry ID 57
Creation 2006-09-05 (Christophe Dunand)
Last sequence changes 2014-05-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-06-12 (Christophe Dunand)
Peroxidase information: AruPrx02 (PrxC2 / PeroxidaseC2 / HRAPRXC2 / HRP_04627)
Name (synonym) AruPrx02 (PrxC2 / PeroxidaseC2 / HRAPRXC2 / HRP_04627)
Class Class III peroxidase    [Orthogroup: Prx035]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Armoracia
Organism Armoracia rusticana (horseradish)    [TaxId: 3704 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AruPrx02
start..stop
S start..stop
AhalPrx37 640 0 1..347 1..346
CrubPrx47 636 0 4..347 2..345
BstrPrx36 632 0 1..347 1..344
AlyPrx38-1 630 0 1..347 1..346
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 244..456 213 N° 2 1687..1878 192 N° 3 2040..2208 169 N° 4 2329..2798 470
join(244..456,1687..1878,2040..2208,2329..2798)


exon

Literature and cross-references AruPrx02 (PrxC2 / PeroxidaseC2 / HRAPRXC2 / HRP_04627)
Literature REFERENCE 1 Fujiyama,K., Takemura,H., Shinmyo,A., Okada,H. and Takano,M. Genomic DNA structure of two new horseradish-peroxidase-encoding genes. Gene 89 (2), 163-169 (1990).
REFERENCE 2 Naatsaari,L., Krainer,F.W., Schubert,M., Glieder,A. and Thallinger,G.G. Peroxidase gene discovery from the horseradish transcriptome. BMC Genomics 15 (1), 227 (2014)
Protein ref. UniProtKB:   K7ZW02   P17179
DNA ref. Galderia Genome:   HE963804.1 GenBank:   D90115
Protein sequence: AruPrx02 (PrxC2 / PeroxidaseC2 / HRAPRXC2 / HRP_04627)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   347 (323)
PWM (Da):   %s   37898.25 (35336.8)  
PI (pH):   %s   8.56 (8.38) Peptide Signal:   %s   cut: 25 range:25-347
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHSSSSLIKLGFLLLLLNVSLSHAQLSPSFYDKTCPQVFDIATNTIKTALRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAFGNARSARGFDVIDTMKAAVEKACPKTVSCADLLAIAAQKSVVLAGGPSWKVPSGRRDSLRGFMDLANDNLPGPSSTLQVLKDKFRNVGLDRPSDLVALSGGHTFGKNQCQFIMDRLYNFSNSGKPDPTLDKSYLSTLRKQCPRNGNLSVLVDFDLRTPTIFDNKYYVNLKENKGLIQSDQELFSSPDASDTIPLVRAYADGQGKFFDAFVEAMIRMGNLSPSTGKQGEIRLNCRVVNSKPKIMDVVDTNDFASSI

Retrieve as FASTA  
Remarks Complete sequence from Genomic (3 introns) and cDNA.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTCCTCTTCCAGTTTGATAAAATTGGGATTTCTTCTTCTTCTTCTTAATGTATCATTGTCTCACGCTCAACTAAGCCCTTCATTTTACGATAAAACATGTCCACAAGTCTTTGAC
ATTGCAACCAATACCATTAAAACTGCGCTGAGATCAGACCCTCGCATCGCTGCGAGCATCCTTCGTCTTCATTTCCACGACTGCTTTGTTAAT
GTAAGATACCACTAGATTCAATATTTT
CACGTATATATTAATTAAGGCCAAATGACTTTTTATTAACGCTAGTAAAAAACCTGTTTAAGTACTTCAACTGTAAACTACCATCTTAAATCTAGCTAATCTATATGGGTTACAATATTT
TTGTACACAAGATTATATTAGATATTATATAAAATTAAAATTATTCATATGGTGTCTAATACTTGTCGCCGTTCACCAATATATCCATAAATTATTGTCCTGTCGCAGAAAAAAATACAA
AAGAGTTGAAATATACTAAAAATATAATCTTACTAGAGATGAGTATTTATCATAGATTTGTTGTCGTTTTCGGATATGATTGATTAAGAAATTTTATTATATAGAATGTCTTTTGGTTCC
CTGATATATCACAATCACAAGCTTGATATTAGGATATCAAAAAGTGATAGACATTTTGATTTGTGGTTCGACTCAAATTGTTTTTTTTGCTTAAAATCGACTCAAATTGTTCGTTTCTCG
GTTTATTCATTTCAAATAGAATATACTCAATAAAGTCTCAAACTGTATAAAAGTTTGTGTTAGTTTTGGTTATTGAAATGTTGGGTTTCTTTTGGTTCAGATTAAAACAAAAGAAAACAC
CGGAGTTAAATAAAAATAGAAATAACAAAATAAAATTATTATATCAACAAAAAATATGTCTTTTAGTTAAATTATTTTATAAGAACTTGATTCGACTTATTTTGACTAATTTTGGTTCAA
TTTGGAGGGGCAGTATTTATAAATGGACCAATCGCTTCTTAAGCAAATTAATATGATTTAAATAGTACAACGTAGATTGCTTTCTTATCTTAACTCTCAAGTTTCAGATTCTGTCGTCAA
AGTATAGTCAAAGATGATTAGTTAATAATTAGCGAACTCATGGCTGTTTCAATTAACTCGGCAAAAACAAAAACAAGTATTGGACTTTTGATGGATTTTTATTTGGGAGATCAAATCAGT
TTTTTTGTCCACCATCGAAATTTGAACTCTAAATTTTCAAAATCTCTCTTTTTTTTTTTTTTTTTGTTAAACCTCTTTATAATTTTTTTTTCTCACAGCAAATCATTATTTACTGATTAG
ATAGCTCAGGATAGGATGGGAAACACAAATTCTTGCACTGTTTACGGATGTTAAGATGTTTTGATTTAACTATGAATATGGTAGTTGACTAAATGTGAAGAACTATATTTAATTTTGAAA
CAGGGATGTGATGCATCGATATTGCTAGACAACACTACATCATTTAGGACTGAGAAAGATGCGTTTGGGAACGCAAGATCAGCTCGAGGCTTCGACGTAATCGACACAATGAAGGCTGCC
GTGGAGAAAGCATGTCCTAAAACCGTTTCATGTGCTGATTTGCTCGCCATTGCAGCTCAAAAATCTGTCGTTTTG
GTATTCTTCTTTTACAATGCTATGCATCTATACATCTTTATTTTT
CTTTCCTTTTTCATTTAAATGGTTTTCATATCATCTTATTGATTTTAATTTTTAGGAGAAACAAGTATTTAAACCATGCAAATATAATTGTTTACTTGAAAATGAAAATAAAATAGGCGG
GAGGTCCTTCATGGAAGGTTCCAAGTGGAAGAAGAGACAGCTTAAGAGGGTTCATGGATCTCGCTAATGATAACCTTCCAGGTCCATCCTCTACACTTCAAGTACTTAAGGACAAATTCA
GAAATGTCGGACTCGACCGTCCTTCTGATCTCGTTGCTCTTTCTG
GTACATTATAGTTAAAAACATTTTCATTTTCATATATAACCTATAGTTGTAGTCATTAATAAACTCTAAATTATT
ATTTGCTTTGGTTTATTAATTCTTTTGATATTTTTCTTTGGTTAGGTGGTCACACCTTTGGCAAAAACCAATGTCAGTTCATAATGGATCGGCTTTACAACTTCAGTAACTCCGGTAAAC
CCGACCCAACCCTTGATAAATCGTACCTCAGCACGCTAAGAAAACAATGCCCACGTAATGGAAACCTGAGTGTATTGGTAGATTTTGATTTACGTACACCGACAATCTTTGACAACAAAT
ACTATGTGAATCTCAAAGAGAACAAAGGTCTTATCCAGAGTGACCAAGAGTTATTCTCTAGCCCTGATGCTTCTGACACTATCCCTTTGGTCCGAGCATACGCTGATGGTCAAGGAAAGT
TTTTTGATGCATTCGTGGAGGCAATGATAAGGATGGGAAATCTTTCACCTTCAACTGGGAAACAAGGAGAAATTAGATTGAATTGTAGAGTGGTGAATTCTAAACCTAAAATCATGGATG
TGGTTGATACTAATGACTTTGCCAGCTCCATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTCCTCTTCCAGTTTGATAAAATTGGGATTTCTTCTTCTTCTTCTTAATGTATCATTGTCTCACGCTCAACTAAGCCCTTCATTTTACGATAAAACATGTCCACAAGTCTTTGAC
ATTGCAACCAATACCATTAAAACTGCGCTGAGATCAGACCCTCGCATCGCTGCGAGCATCCTTCGTCTTCATTTCCACGACTGCTTTGTTAAT
GGATGTGATGCATCGATATTGCTAGAC
AACACTACATCATTTAGGACTGAGAAAGATGCGTTTGGGAACGCAAGATCAGCTCGAGGCTTCGACGTAATCGACACAATGAAGGCTGCCGTGGAGAAAGCATGTCCTAAAACCGTTTCA
TGTGCTGATTTGCTCGCCATTGCAGCTCAAAAATCTGTCGTTTTG
GCGGGAGGTCCTTCATGGAAGGTTCCAAGTGGAAGAAGAGACAGCTTAAGAGGGTTCATGGATCTCGCTAATGAT
AACCTTCCAGGTCCATCCTCTACACTTCAAGTACTTAAGGACAAATTCAGAAATGTCGGACTCGACCGTCCTTCTGATCTCGTTGCTCTTTCTG
GTGGTCACACCTTTGGCAAAAACCAA
TGTCAGTTCATAATGGATCGGCTTTACAACTTCAGTAACTCCGGTAAACCCGACCCAACCCTTGATAAATCGTACCTCAGCACGCTAAGAAAACAATGCCCACGTAATGGAAACCTGAGT
GTATTGGTAGATTTTGATTTACGTACACCGACAATCTTTGACAACAAATACTATGTGAATCTCAAAGAGAACAAAGGTCTTATCCAGAGTGACCAAGAGTTATTCTCTAGCCCTGATGCT
TCTGACACTATCCCTTTGGTCCGAGCATACGCTGATGGTCAAGGAAAGTTTTTTGATGCATTCGTGGAGGCAATGATAAGGATGGGAAATCTTTCACCTTCAACTGGGAAACAAGGAGAA
ATTAGATTGAATTGTAGAGTGGTGAATTCTAAACCTAAAATCATGGATGTGGTTGATACTAATGACTTTGCCAGCTCCATCTGA

Retrieve as FASTA