Entry information : MtGPx04 (Medtr1g072570.1 [4.0] / Medtr1g072570.1 [3.5])
Entry ID 5701
Creation 2008-12-29 (Christophe Dunand)
Last sequence changes 2014-07-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-31 (Christophe Dunand)
Peroxidase information: MtGPx04 (Medtr1g072570.1 [4.0] / Medtr1g072570.1 [3.5])
Name (synonym) MtGPx04 (Medtr1g072570.1 [4.0] / Medtr1g072570.1 [3.5])
Class Plant glutathione peroxidase     [Orthogroup: Gpx2002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Seedling roots
Inducer Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtGPx04
start..stop
S start..stop
MtGPx05 266 6e-93 1..168 1..167
EgrGPx09 259 3e-90 1..168 1..167
EguGPx09 259 4e-90 1..168 1..167
GhGPx05 256 3e-89 1..170 1..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32218326..32218379 54 N° 2 32218031..32218107 77 N° 3 32217852..32217913 62 N° 4 32217613..32217731 119
N° 5 32217248..32217418 171 N° 6 32217099..32217134 36  
complement(join(32217099..32217134,32217248..32217418,32217613..32217731,3221785 2..32217913,32218031..32218107,32218326..32218379))


exon

Literature and cross-references MtGPx04 (Medtr1g072570.1 [4.0] / Medtr1g072570.1 [3.5])
DNA ref. GenBank:   AC158374.1 (11983..13676) Phytozome 11:   chr1 (32218379..32217099)
EST ref. GenBank:   BF004012 [3' end]   BF004318 [3' end]
Cluster/Prediction ref. Phytozome Gene 11:   31099129
Protein sequence: MtGPx04 (Medtr1g072570.1 [4.0] / Medtr1g072570.1 [3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 172
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
19408.16  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
9.72
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGATQSVLENSIHEYKVKDARGKEVNLGIYRGKVLLVVNVASKCNFADANYTQLTQLYTKYKEGLEILGFPCNQFLRKEPGTSQEAQDFACDRYKAEYPILGIRVNGQDTAPVYKYLKSQKCGSLGSRRIKWNFTKFLVDEEGRVIQRYSPTTQPLAIENDIKKALRVAN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo1, 5 introns) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCTACACAATCAGTCTTGGAAAATTCTATTCATGAATACAAAGTCAAGGTATAAGCTATACACCGTTAATGTAAAAATGTTTTATACTGTCGATAAATTAATCATAACGTTCTA
TCATATCGTTAAAAACGTTAAACATTAATCATAACTATTTCTAAAGTCATAGATATATTTGACGATGTATAAATAAAAATAAAACTATACATGAATATCAAATCAAAGTCTTGACCGAAA
CAAATTCATTATCATTGTGGTGTTTGGAACAGGATGCAAGGGGCAAAGAAGTGAACCTTGGTATCTACAGAGGGAAAGTTCTTCTTGTAGTTAATGTTGCTTCAAAATGGTTGTTATTTT
CATTTTCTAATAAATCTACTTTCTTATTGTGTTTGTTTCCTACTTTCTTCCTTAATTTTATGGCTAACTAATTCATGGACGTTAAAACAAAAAAAAAAAAAAACAGCAACTTTGCAGATG
CCAATTACACCCAGTTAACTCAGCTTTACACCAAATACAAGGAGATAG
GTATGCATATGTTATTTATTTATTTATCAGAATTGATGTCTAACATAAAGAAAATATTATCACGTATTTTGA
TTCATGTAATCTGATTTGAGAATATATGTCTTTGTTTGTTGATGTTAGGTCTTGAGATATTGGGATTTCCATGCAATCAATTTTTAAGGAAAGAACCAGGGACTAGTCAGGAGGCACAAG
ATTTTGCCTGTGACAGATATAAGGCTGAGTATCCCATTTTAGGGAAG
GTATGATATAATATGTGATGCTTCTTGCACAAGTTTTTGGTTTTTGGTGCTAATAATTTGAAAAAAAAAAAAT
CACATAATTTAGTATAATTATATGCATCGATATCGGACGTGAGACACGTGCTTTATAGATGACACATAATGTAACACATTGGGTGATTAATGTTACACATGAAATATGTTTAAATGTGTA
GATACGTGTGAATGGACAAGATACAGCACCTGTGTATAAATACCTGAAATCACAAAAATGTGGAAGTTTGGGATCAAGAAGGATCAAGTGGAATTTTACAAAGTTTTTAGTTGATGAGGA
AGGCCGTGTCATCCAACGTTATAGTCCAACCACCCAACCATTAGCCATTGAA
GTACTTTTTCTTTCTCTCTCTGAAATTGCTTTGTATACATATTTCATTATCTATGCATATTTATATAT
CTTTGAGAGGTTAAATTATTTTGCATTTTCACATATCTTTGACAGAATGATATCAAGAAAGCACTGAGAGTGGCTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCTACACAATCAGTCTTGGAAAATTCTATTCATGAATACAAAGTCAAGGATGCAAGGGGCAAAGAAGTGAACCTTGGTATCTACAGAGGGAAAGTTCTTCTTGTAGTTAATGTT
GCTTCAAAATG
CAACTTTGCAGATGCCAATTACACCCAGTTAACTCAGCTTTACACCAAATACAAGGAGATAGGTCTTGAGATATTGGGATTTCCATGCAATCAATTTTTAAGGAAAGAA
CCAGGGACTAGTCAGGAGGCACAAGATTTTGCCTGTGACAGATATAAGGCTGAGTATCCCATTTTAGGGAAG
ATACGTGTGAATGGACAAGATACAGCACCTGTGTATAAATACCTGAAA
TCACAAAAATGTGGAAGTTTGGGATCAAGAAGGATCAAGTGGAATTTTACAAAGTTTTTAGTTGATGAGGAAGGCCGTGTCATCCAACGTTATAGTCCAACCACCCAACCATTAGCCATT
GAA
AATGATATCAAGAAAGCACTGAGAGTGGCTAATTGA

Retrieve as FASTA