Entry information : CsGPx02 ( orange1.1g028944m)
Entry ID 5715
Creation 2007-08-14 (Christophe Dunand)
Last sequence changes 2016-04-06 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-04-07 (Catherine Mathe)
Peroxidase information: CsGPx02 ( orange1.1g028944m)
Name (synonym) CsGPx02 ( orange1.1g028944m)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsGPx02
start..stop
S start..stop
CclGPx02 395 4e-143 1..194 1..194
EcamGPx01 297 2e-104 3..199 1..197
EglGPx01 296 1e-103 3..194 1..192
EguGPx01 296 1e-103 3..194 1..192
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 36420..36575 156 N° 2 36961..37037 77 N° 3 37802..37863 62 N° 4 37969..38087 119
N° 5 38183..38374 192  
join(36420..36575,36961..37037,37802..37863,37969..38087,38183..38374)


exon

Literature and cross-references CsGPx02 ( orange1.1g028944m)
Literature Close,T.J., Roose,M.L., Federici,C.F., Mandal,J., Fenton,R.D., Luck ,R., Forster,L., Morse,J., Flores,P., Wanamaker,S., Kim,H.R., Kudrna,D., Collura,K., Wissotski,M., Byrne,M., Stum,D., Smart,D., Muller,C. and Wing,R. Development of EST Resources and New Genetic Markers for California Citrus - Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11.
EST ref. GenBank:   DN620642 [3' end]
Cluster/Prediction ref. UniGene:   Csi.1341
Protein sequence: CsGPx02 ( orange1.1g028944m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   201
PWM (Da):   %s   22698.63 Transmb domain:   %s   i9-26o
PI (pH):   %s   9.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTLRLMKNSNWVSFLFIVFAFFLYFYKYPSSFSAKNMATQEAPKSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNDFEVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEVGTTIPL*

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATTGCGTTTGATGAAAAATAGCAACTGGGTTTCATTCCTTTTTATTGTTTTCGCGTTTTTCTTGTATTTTTACAAATACCCATCTTCTTTTTCTGCAAAGAATATGGCTACGCAA
GAGGCTCCCAAGTCCATCTATGACTTCACTGTCAAG
GTATTTTTTTTTTCCTCCGCTTTTTTAGGTTATGAATTTTATGCTTTATGTTTCGTTGTTTTCATGGAAGTTTATGTATTTAAG
CATCAGCTTTGGTTAGATTGCTGCTGTGGGCTGTTGTAAACTGCTCCATTGGATTTATTAGCTTTTCACGTTTTGATTGTTAGTGATTTGTTATATATTTTGATTTTATTGATAATTTGG
TAGTTGACGTTCTTAAGAAATTGAGCACCACATAAATTTTATGTTTTGGTCTGTGTCTAATTTTTGTTCTGTTTGGACCCTGAAAAACGAAAAATGATATATAAACATCTTACAAGAATC
GGCGATTTTGAAGGGCTCTGACGATATCTGCATGTGCTCTGATAATTGGGTTCAATTTCAGGATATTCGTGGAAATGATGTGAGTCTAAGTGGGTACCGTGGGAAGGTTCTTCTGGTAGT
GAATGTTGCTTCCAAATG
GTAATGTAGCTTTATTTCTTCTACATTAAAATGTCTTGATGAACATTCCTATGACATGGTAATACTTTTAATCTCCTAATTGCATTTCCAATCTTTATTTAT
GCCATGTAGGCGCATATTATATACTTCATGCTGTGTAAACTTTGCTCACCCCAGTTTGTAATATGATTGAGGCAAAATTAGTTGCAATTGTCATCCCTATATTTTGTATTGAGGCTGAAA
TTCAGTGTTAGTCAGGTAGACACCATAGCTTAGCGTTAGAAATACTGCAACATCTTGTATCAGATCTTATGCTGTCTTCTCTAAATTCTCATACACAGGCATGGCTATATAATTTCGGTT
GATAGATGCACTGGGAATGGATTTCAGAGTTTGAACAATTGGAAGTAACATAGAAAGAACAGAGCTTATAATCTGCCTCAAACATAATATTGTGGCCCCCCCTTGATCTAGTTCATTTCA
TTTTCGGCCACTAGAAGTGACACAATTTTCTTCCCTTCTGGACTATGGTGAGGTGTTTTACACAAATTAATAGGTTGGGTAACAGATATGCTTTGCTCAATATAGAATGGCACTCTGGTC
ACCGCTGTTGTTTAATAAAAGAAAGTTGCTGTTCTCCATCTGAAACTGAATGCAGAGAGTGATAATCTCTTTTCCAAGGCTGAAGCTTGTCATGTGTCTTGTGCTTGAATTAGCTAGCAA
GCTGCAGGTTTTCTTGCTTGATATCTTTTGTGTTTCTCATGTTATATTATCATTCTTTGCAGTGGCTTAACGCAATCTAACTATAAGGAACTGAATGTTTTGTATGAAAAATACAAAAAC
CAAG
GTCTGTATTTCATTCTTGCCCGGCCATGTAATAAGTTTGTTGAGTTCCATAATGTTTCCAAAGACTAGAATTTAGTCTCCTAAACGAGCAGAACTGCTAATGCAGACTTTGAGGTC
CTTGCGTTCCCTTGCAACCAGTTTGCAGGACAGGAGCCAGGAAGCAATGAGGAAATTCAGGAAGTTGCATGCACAATGTTCAAAGCTGAATTCCCAATCTTTGATAAG
GTAATCCTTTAT
ACGCAGAAGACCAGTTCAAAGTAAAAGTTTCTTCTCAACCCATATGCACAATGTTTTAACACTGCTTTACTTTGCTATGGTAGATTGATGTGAATGGAAAGAATGCGGCACCTATTTACA
AGTTTCTAAAATCAGAGAAAGGAGGATTCCTTGGAGATGCAATCAAGTGGAATTTTACCAAGTTTCTGGTTAATAAAGAAGGGAAGGTTGTAGAGAGATATGCTCCTACAACATCACCTC
TTAAGATCGAGGTTGGAACAACGATTCCTCTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATTGCGTTTGATGAAAAATAGCAACTGGGTTTCATTCCTTTTTATTGTTTTCGCGTTTTTCTTGTATTTTTACAAATACCCATCTTCTTTTTCTGCAAAGAATATGGCTACGCAA
GAGGCTCCCAAGTCCATCTATGACTTCACTGTCAAG
GATATTCGTGGAAATGATGTGAGTCTAAGTGGGTACCGTGGGAAGGTTCTTCTGGTAGTGAATGTTGCTTCCAAATGTGGCTTA
ACGCAATCTAACTATAAGGAACTGAATGTTTTGTATGAAAAATACAAAAACCAAG
ACTTTGAGGTCCTTGCGTTCCCTTGCAACCAGTTTGCAGGACAGGAGCCAGGAAGCAATGAGGAA
ATTCAGGAAGTTGCATGCACAATGTTCAAAGCTGAATTCCCAATCTTTGATAAG
ATTGATGTGAATGGAAAGAATGCGGCACCTATTTACAAGTTTCTAAAATCAGAGAAAGGAGGATTC
CTTGGAGATGCAATCAAGTGGAATTTTACCAAGTTTCTGGTTAATAAAGAAGGGAAGGTTGTAGAGAGATATGCTCCTACAACATCACCTCTTAAGATCGAGGTTGGAACAACGATTCCT
CTTTGA

Retrieve as FASTA