Entry information : OsGPx
Entry ID 5730
Creation 2007-08-16 (Christophe Dunand)
Last sequence changes 2014-01-20 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: OsGPx
Name OsGPx
Class Plant glutathione peroxidase    [Orthogroup: Gpx2006]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsGPx
start..stop
S start..stop
TaGPx06-1A 301 7e-107 1..171 1..171
TaGPx06-1B 300 2e-106 1..169 1..169
HvGPx06 298 9e-106 1..169 1..169
SbGPx06 289 6e-102 1..171 1..171
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..60 60 N° 2 323..399 77 N° 3 480..541 62 N° 4 990..1061 72
N° 5 1164..1331 168 N° 6 1418..1447 30  
join(1..60,323..399,480..541,990..1061,1164..1331,1418..1447)


exon

Literature and cross-references OsGPx
Literature Li R., Fan W., Zhang J., Zheng H., Zhang Y., Li J., Zhao M., McDermott J., Samudrala R., Kristiansen K., Wang J., Wong G.K.-S. Re-annotation of the rice genome(s) by selective pre-masking of intergenic transposable elements. Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases
Protein ref. UniProtKB:   Q259Q9 [Incorrect splicing]   Q7XPV2 [Incorrect splicing] UniProtKB_Uniparc:   A3AYS5 [Incorrect splicing]
DNA ref. GenBank:   NC_008397.1 (34955779..34957222)
Protein sequence: OsGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18654.54  
PI (pH):   %s   8.43
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAAESSSKLAGSIHEFTVKDARGSDVELSRYKGKVVLIVNAASRCGLTNYNYTELGQLYGKYKEARQQ*AGCGVCLYPLQSRVSYPWQG*CEWRQCCSTVQVLEVRERWPLRRTHQMELHQISG*QRGSCGEPLCTNQLPIEH*E*HQEPARX

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 4, 5 introns). Four SwissProt/TREMBL accessions: not correct splicing prediction: missing sequence (Q7XPV2) and previous ORF is associated to the GPX (A3AYS5, Q259Q9). No EST has been found but TaGPx06 has 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGCAGCTGAGTCATCTTCAAAGCTCGCTGGCTCCATCCATGAATTCACTGTGAAGGTCTGTTGAGCGCCTGTCCCTCCTTCCATTTCTCTAGAATTATTTATTCTTATTTTTTAT
CAAGCATGTTGAGAGGTTTTATGGGAAATTTTGAAGAAGCCACGTTGAAGTGTCTGTGAACCAATGCAATCGGGCTATTTGAAAATTGATAATACAAGAACAAGAGATGGAGTTTTTCAA
TGACAGGGTCTCTATTCCCATTCATCCAACTTTGATTTCATTTCGTCGTGTTTAAATAACGGTCTGTGGAATAATTCTGCAGGATGCGAGGGGGAGTGATGTGGAACTCAGCAGATACAA
GGGAAAAGTTGTTCTTATTGTGAATGCTGCATCTCGATG
GTATTGGTCTTTACATTTTCATTCGAAATTGTCTAATGAGAGTTTGTACTTTCCCACCTGATCTGATGATATCTCTGCAGT
GGTCTGACGAATTACAACTACACTGAACTTGGTCAGTTATATGGGAAATACAAGGAGACAG
GTACTAGTTGTTTACCTATATGACAGTACGTTTGTTGCAACTCGGCTCTGAAGTCACGC
GAATACCTTTATGAAGTACTTTTGGAGAAATCGCTGCAAATTTCTTGAATCTTGACCAGTGCTCATTTTTCAGTATCGGTTTTTTTAATAACATTTTTAGACTTTTATCTGTGGGCACTG
GGCAGCTGTATAATACCGTACTGCTGTTATTGCTTTTACTCTGAAGAAAGTATTCACTCTCTTATCGTTTCCTCTGCCGTCCAGTTAAATTGCATCAAATCTTTCAGTTTCCCCTTGACA
CCTCAATTGTAATTTATGAGAGCATAACGCTGTCCGTTGACAGTCTACAATGACCTCAATTGCTTTGTATTTCCCCTTTTTCTTGTGCAATTAGGATTGGAGATATTGGCGTTCCCATGC
AATCAATTTGCAGGACAGGAGCCACCGAGCCAGGCAGCAATGAGCAGGTTGTGGAGTTTGCTTGTACCCGCTTCAAAGCAGAGTATCCTATCCTTGGCAAGGTCCAACCAATGGCAATCT
TTTCTTCCAGTGCTAGCTTCCAAAACCATATCCAATTATTTGTTGTTTCGGTCTAAAATCAACGCGCCCGAGTTGTCAAACAGGTTGATGTGAATGGCGGCAATGCTGCTCCACTGTACA
AGTTCTTGAAGTCAGAGAGAGGTGGCCTCTTCGGAGAACGCATCAAATGGAACTTCACCAAATTTCTGGTTGACAAAGAGGGTCATGTGGTGAACCGTTATGCACCAACCAGCTCCCCAT
TGAGCATTGAG
GTGATGAAACAAAACAGTGTTCGTTTTCATTTTATTATATAGCTTCACAGGCATGATTACTCATCAGTCAATGGTTGTTTCTGCAGAATGACATCAAGAACCTGCTAGG
GGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGCAGCTGAGTCATCTTCAAAGCTCGCTGGCTCCATCCATGAATTCACTGTGAAGGATGCGAGGGGGAGTGATGTGGAACTCAGCAGATACAAGGGAAAAGTTGTTCTTATTGTG
AATGCTGCATCTCGATG
TGGTCTGACGAATTACAACTACACTGAACTTGGTCAGTTATATGGGAAATACAAGGAGACAGCCAGGCAGCAATGAGCAGGTTGTGGAGTTTGCTTGTACCCG
CTTCAAAGCAGAGTATCCTATCCTTGGCAAG
GTTGATGTGAATGGCGGCAATGCTGCTCCACTGTACAAGTTCTTGAAGTCAGAGAGAGGTGGCCTCTTCGGAGAACGCATCAAATGGAA
CTTCACCAAATTTCTGGTTGACAAAGAGGGTCATGTGGTGAACCGTTATGCACCAACCAGCTCCCCATTGAGCATTGAG
AATGACATCAAGAACCTGCTAGGGGCTTAG

Retrieve as FASTA