Entry information : ZmGPx04
Entry ID 5740
Creation 2007-08-17 (Christophe Dunand)
Last sequence changes 2007-08-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmGPx04
Name ZmGPx04
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmGPx04
start..stop
S start..stop
TaGPx04-1A 432 8e-157 1..230 1..229
SbGPx04 400 7e-144 1..230 1..232
OruGPx04 343 2e-121 5..230 15..234
OsiGPx04 338 2e-119 10..230 7..232
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 106959814..106960050 237 N° 2 106961523..106961599 77 N° 3 106961690..106961751 62 N° 4 106962652..106962770 119
N° 5 106962896..106963063 168 N° 6 106964341..106964370 30  
join(106959814..106960050,106961523..106961599,106961690..106961751,106962652..1 06962770,106962896..106963063,106964341..106964370)


exon

Literature and cross-references ZmGPx04
Literature Collura,K., Wissotski,M., Campos,D., Kudrna,D., Golser,W., Ashely ,E., Haller,K., Wing,R., Soderlund,C., Walbot,V. and Yu,Y. Maize Full-length cDNA Project.
Protein ref. UniProtKB:   B6U7S4   B4FR46 [5' end]   B6U7G0 [Mismatch]
DNA ref. GenBank:   AC195968.2 (68389..72948)
mRNA ref. GenBank:   EU973289
EST ref. GenBank:   EE012294
Cluster/Prediction ref. UniGene:   Zm.84644   Zm.96672
Protein sequence: ZmGPx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   230
PWM (Da):   %s   24906.96  
PI (pH):   %s   10.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPSFTSLLSAANSAAAATASRLPSAAAGRASTFVRFPHHPTGWAGASVAAPRTARKRAPGVAYATAATEKSIYDYTVKDIDGKDVPLKKFKNKVLLIVNVASQCGLTTANYTELSHIYEKYKTGFEILAFPCNQFGAQEPGSNTQIKQFACTRFKAEFPIFDVDVNGPNTAPIYKFLKSSAGGFLGDLVKWNFEKFLVDKNGKVIERYPPTTSPFQIEKDIQKLLAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 4 introns) and 19 + 4 ESTs. Cultivar="B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCCTCGTTCACTAGCCTCCTCTCGGCCGCGAACTCCGCCGCCGCCGCGACCGCCTCGCGGCTCCCCTCGGCCGCCGCCGGACGGGCATCCACTTTTGTGCGCTTCCCGCATCAC
CCGACGGGCTGGGCTGGGGCCTCCGTCGCGGCGCCGCGTACGGCGCGCAAGCGGGCACCCGGCGTCGCCTACGCCACCGCAGCTACCGAGAAGAGCATCTACGACTACACCGTTAAG
GTG
GCCTATTTCTTTTGTTCTGTTGAGATTTCCGTTCGCCATGGCCCCGTAATTTTTGCTAATGGATGGCGTTGCGTTGTGACGTGGTGACATGCCTGAAGCCGTTTAAGCGGGGTTTAACGG
AAGCACCGTCTGATTTAGTCCGGTTTTGTATCGCTGATTGTTGCGTGCTGTTACTGTATTAGGTATTGCTGGGGTGTTGTTGTTGGGTAGGTGGGGGCGTTGCAACCATAGACTGATTGG
TGTTTTTAATGTTCCCTGGCGCTGACTGTTTGATACTTTGATAATTGGCTGAAACATCCATCACGTGGATGCTATTGAAGCATTGTTTTCAAAACCAAATGTGTATGGCAATATTACTAG
CACTATCAGGGTTGCAATGTGTAGCGATCGTAGATGTTTCGTGGAATTATGTGTTCTAAGGAGTTGTCGAGGTAGGCACAAATCTGTAACCATGGGCAAATCAATTTTATGATATATTGT
TGTGGAACTTGGCTGAAGTTGGCCAAATCAGGTTAACAGAGTCAGCCAATTTTGCAGATCAGGTCCTTCTAAGGTTAGGTATCAAGGGCGCAGAGTGTTGTAGCAGTAGACTGAATGATT
CCCCATTCTTCTTAATTTTAAGGATGCAAAGTACACTGTGCTTGTTTTCCAACTACCATTCCACGTAATTTGTAAAATGGATATTATCGTTTATTGGCATGTAATGTTAACCAACCAGAT
GGTTTGCTGAAATTTCACAGAACAAACCTTCTGATAGAAATAAGTTTGCATCTGAGTCATGCTTTAAGATGACAGTATTAAACCCACCATGGATAGTGCTGTCCAATGATGTGTTCATTC
ATGTGCATATTTTCAATTGATTGAACTTGTAAATATTTCTATATGTCCTTTCAACTTATTGGCAAATTTAAGGTGCATGCCATGTTTGAAGGTGGGCATTATAAAACATTGTTCTAGGAC
GGTATTAGGAAATTCTTGTAGCCCTAGACTTATTAGACCAGTTAACCAGCTATGCCTAGTGAATTACTTAAAATAGAAGGGTGGTTAGTTGCAGAGATATCAAAAATGCAAAATTGTACA
TGCAATACATGTCCACATAGGATCACAGTGAAATTAAAGTAAAACAAAGAGAGATTATTATGAGAAATTTTATGGGATACCATTTGTTTAGTTGTGAAATCCGAAGTTTGTGAATTTTAT
GTTTCCCTAATGCTTTTTCTCCACATGTCGTATTTTATTGCCATCTTACATACGGATACATGAAGAAATAACCTTGCAAGTGTGTAGTGTAAGGTTTTCGGGCCTGGTTTTCCTTATAAA
CTCAGTCTACCCTTTTCTATCTTAATTGAAAGGCAGACCTCCTGCCACTTGCATTCAAAAAAAACATGAAGAAATTACTTTGGTACTTTATCTTAATATGAGATCGAATATGTATGCACT
TGTATCTGAAAGAATTATTCACTTTTCAGGACATTGATGGAAAAGATGTTCCTCTTAAAAAGTTCAAGAATAAGGTGTTGCTGATTGTTAACGTTGCTTCTCAATGGTAATTTCACTGAA
AAATCTTTCACCAACCACATTCTTTGTTTTTTTATGTTTGCTGGCATTTAACTTGGCATTCATCTGTGGATCTCAGTGGGTTGACAACAGCAAATTACACTGAACTATCTCATATCTATG
AGAAGTACAAGACTCAAG
GTGTGGCAATTTACACTGAACAATGTTGTGTATACTTATCATTTTTAGGAAATCTAGACTGAACATTGTATTTCCAATTAAAGGAGTTACCAAAAGTTAAAG
TTGTTGTACCCTTTAAATTGTGTGTTTGATCCTAATTGTCTCATAAAACCACACAATCAAGACCAGCAGTTTAACTCTAATATATGCTGTTTTTCTTGTTTATGCCAATTTATGGGATCA
TTCAATTAGACCTCTTGTTATTATATAGTGACCTTTTTGTTTGTCGCATATATCCTGGCACGTATGTAACCTAGAGAGTTGGTGTGGAGAGGGAGGACTTCATGCCTCTCCCTCTTGTAT
TTGTGTTTTTCTTCTATCTTAATGAAATAACACGTAGCTCTCCTGCGGAGTTCGAGAAAAAAAGTACGCCTATTCTACTGGACCATGTTGATGCATTTGCTGATTGTCCTGATTTTTGTT
GTCTAGTGGGCGTGGGTCTCGGAGGTTAAAGGTTTCTATTGCTTTTTGCAATATTTCTTGAGTCATCTAGCTTAATATATCTCTGTGGGCGAGGACCCACATTGAGCCTAGCCAGGGCAG
GCCCACACTCATTATTCTGTTTAAGTGGACATTGGGCCTTGTTTACGGTAGGTGTAAAAGCACAGTAGTTACCAGACCCTTGCTTGTTTTTTGGGCTGGTCTGCCCTTAGTGTGTACAGT
CATTCCAAATGTTGTCGTCATGAAGAGGATCCTCCTGGACTCTACAGTTAGTTTCAAAAGTCAACTTTAGAGTTTTGATGCACATTCTCTTAGATACATGAAAAGGAAATGTTGATGTTA
GCACGAACCTTGACTTCTTGGGCTAATAGTTGCCATTTTACATTGTGTTGTTTAATAGTTAATCTATTTGACATGTAGGGTTTGAGATCCTTGCATTTCCTTGCAATCAATTTGGTGCAC
AAGAACCTGGATCAAATACTCAGATTAAGCAGTTTGCATGTACAAGATTCAAAGCTGAATTTCCGATTTTTGACAAG
GTATGCTGATTGCAGGCAGTTCAGTCATTTGTTCCATAGTTTA
TCCTGCTTAACATTATCTGACTTTACAAATAAAAAAATATTTGTGCATGATGTATCTTTTGTTCTTCTTTCTACAATTTCAGGTTGATGTCAATGGACCTAATACAGCTCCCATCTATAA
ATTTCTGAAGTCCAGTGCAGGAGGATTTTTGGGTGATCTCGTGAAATGGAATTTTGAGAAGTTCTTAGTGGATAAGAATGGCAAAGTCATTGAGAGATATCCACCAACAACTTCACCTTT
CCAGATTGAG
GTGTGTGATTACATCTCTAGCTTTCTACAGCACACCTTCTTTGTTTGTATATTCAGTCTATTTTTGGACTCTGTTGCTCAAAATGAACATTTTCTTCTTTTCCATATGGT
TATAAAGGCTGATAGATACTTAATTAGGTGATGAATACTTAATTACATATGCCTATGCAGTGCTATCAATCATTCATTTCCCTATTAAGTAGTGATCTTGTGAGCATATCATGTGTCAAT
TAAGCGGAAGCATGCAATCTTAATATCTATAACCTATGAAACATTTTTGAATAATCAATGAAACTAAGAACTAAATCAATCTGTACTCGACAGTTGGTTTTTGTGTATTAAATTTGAAAC
AAAAAGATAGAAAAAACAACCACCTGTGGACCCAATAAATAATAATAGATTTTGTGTACATCACGTTTAGGGATGATGACTTCGACAAACATCTTTTGGAGTGTCATTTAACACGTTTTG
CTCATAAAGTTGCTTTACTGATCAGCTTGAGGAATGGCATTTTAAATTTTTCTTGAGGCTTGGTGCTTGGTACACCAATAGCACAGAAAGTATTCGATAGGTAGGCAACTAGGGTGCTGT
GCATCCACCTGAAATCATCAACCTTGTCACATTTGGGCTTCAATTGTTAACTCTTTGGCCCTACAAGGCTATAACAGAGAGCTTCATATGGAATTTCCAAGTGGCTCTAGTAGTCGTGTT
TGGCAGTGCTGACGAATAGAATGTGCCTATGAAAAGACTTTTTCAATGACAGTGCTCATCAATTCGTGATAATTCTAATACATGAGTTACCCATGCTCAAGCAGCCCTGTGCCAACGGTG
GCATTAAGATTGTTTTGCTCTAGGGGAGACTTTTACTGATGTTCTGGAGCTCGCTTTGTCAAAAGAAGCATCCAGTGTTGGCTTTGGTATAAAATATTCTCAAGTTGCAGTAATGGATCA
GTTCTAGACTTCCATCGTGTTTTGTGCTGTCAGCAAAAAAAAAAAATGCTTTCAACCTATTCTTTCTGTCACATTTCAGTGCATTAAGACAGCTTTGCCACACACTCATTGGCTTCGAAA
TCTTTCGGTCGGTTTCAGTTTTAAAATGGCCACTTTTGTGTCTCATCGAGTCGCACGCTCACCTGACTTCTTGCGGTTATGATTTCATAGACCACTTGCTTAAGAAATAAATCCAAACCC
TTTGTGCCGACCTCCCTGCGGTTTTCGGTTTTCATTACGATTTCACGTTGCTCACAGCCTCCTTGCTATATGATTTTATTCTTGCAGAAGGACATCCAGAAACTGCTCGCGGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCCTCGTTCACTAGCCTCCTCTCGGCCGCGAACTCCGCCGCCGCCGCGACCGCCTCGCGGCTCCCCTCGGCCGCCGCCGGACGGGCATCCACTTTTGTGCGCTTCCCGCATCAC
CCGACGGGCTGGGCTGGGGCCTCCGTCGCGGCGCCGCGTACGGCGCGCAAGCGGGCACCCGGCGTCGCCTACGCCACCGCAGCTACCGAGAAGAGCATCTACGACTACACCGTTAAG
GAC
ATTGATGGAAAAGATGTTCCTCTTAAAAAGTTCAAGAATAAGGTGTTGCTGATTGTTAACGTTGCTTCTCAATG
TGGGTTGACAACAGCAAATTACACTGAACTATCTCATATCTATGAG
AAGTACAAGACTCAAG
GGTTTGAGATCCTTGCATTTCCTTGCAATCAATTTGGTGCACAAGAACCTGGATCAAATACTCAGATTAAGCAGTTTGCATGTACAAGATTCAAAGCTGAATTT
CCGATTTTTGACAAG
GTTGATGTCAATGGACCTAATACAGCTCCCATCTATAAATTTCTGAAGTCCAGTGCAGGAGGATTTTTGGGTGATCTCGTGAAATGGAATTTTGAGAAGTTCTTA
GTGGATAAGAATGGCAAAGTCATTGAGAGATATCCACCAACAACTTCACCTTTCCAGATTGAG
AAGGACATCCAGAAACTGCTCGCGGCATAA

Retrieve as FASTA