Entry information : ZmGPx03-2
Entry ID 5741
Creation 2007-09-03 (Christophe Dunand)
Last sequence changes 2007-09-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmGPx03-2
Name ZmGPx03-2
Class Plant glutathione peroxidase    [Orthogroup: Gpx2007]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmGPx03-2
start..stop
S start..stop
ZmGPx01-3 338 1e-121 1..166 1..167
SbGPx07 301 4e-107 1..163 1..163
SpGPx01 278 7e-98 1..165 1..168
SbGPx01 278 7e-98 1..165 1..168
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 56781675..56781713 39 N° 2 56781831..56781907 77 N° 3 56782028..56782089 62 N° 4 56782229..56782347 119
N° 5 56782524..56782691 168 N° 6 56782781..56782816 36  
join(56781675..56781713,56781831..56781907,56782028..56782089,56782229..56782347 ,56782524..56782691,56782781..56782816)


exon

Literature and cross-references ZmGPx03-2
DNA ref. GenBank:   AC204541 (15515..16656)
Protein sequence: ZmGPx03-2
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   18175.23  
PI (pH):   %s   7.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAASSVHGFTVKDASGEDVHLSTFKGKVLLIVNVASQCGLTNSNYTELAQLHEMYKDDFEILAFPCNQFGGQEPGTSEEIVQLVCARFKAKYPILHVDVNGEDAAPIYKFLKSSKTGPMGEDIKWNFAKFLVDRQGHVAERYAPTTYPLSIQKDIKKLLGGSY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 1, 5 introns). No ESTs. The contig contains a second GPx very similar.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCCGCCAGCTCCGTCCACGGCTTCACCGTCAAGGTCCGGCCGCCTGCTAGTGCTAGCTAGTAGTTCCCTTGGAAAACTAATGCGTGCGAACGGTGATTCAGAAGTGCATGCATG
CGTTATATCACATTGTCTGTGTGTGTGTGTGTGTAGGACGCAAGCGGCGAAGACGTGCACCTGAGCACCTTCAAGGGCAAGGTTCTCCTCATCGTCAACGTCGCATCACAGTGGTAATAT
ACTACATACAGCCACCATGCATTATGTTCCCTCTGTCAGCACATACAGCATATGCGTCTGAGCGATTGCATGCCTAAACAATGTAACTGTTGTTTCTTTACAATGACACACAGTGGCCTG
ACCAACTCCAACTACACGGAGCTTGCCCAGCTACACGAGATGTACAAGGACCAGG
GTGAGTCTCTGTCGGTCGCCTTTCAGAGAGACATCGATCGAATCCAGTTTCTCTTCTGGTTATGC
CCGTTTTCCTCATGTAATTAATTATTTGGGTCGGTTATGATTCATAATTTGGCGTACGTGACGACGACCTTCAGATTTCGAGATCCTTGCGTTCCCGTGCAACCAGTTCGGCGGGCAGGA
GCCCGGCACGAGCGAGGAGATCGTCCAGCTCGTCTGCGCTCGCTTCAAGGCCAAGTACCCGATTCTTCACAAG
GTAAATTTAATTCTGTGCGCGCAAACCTTTCTTATAAATTTCTGGGT
TTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTTTGCATGTCCAAGCTGAAATAGACAACGATCGATCACATGCAATTAATAACAACACGTGTTTTCGGCGTTTGTTTTTTGCC
GGCCGTAAGGTCGATGTGAACGGCGAGGACGCTGCGCCCATCTACAAGTTTCTGAAATCCAGCAAGACCGGCCCCATGGGCGAAGACATCAAGTGGAACTTCGCCAAGTTCTTGGTGGAC
AGACAGGGGCATGTCGCCGAGCGGTATGCTCCGACCACCTACCCACTCAGCATCCAG
GTGAGTGAGGAGGCGCGCGCGGTTCAGCTTCCTCGATCGGTCATCTCATGTGATCTTACTACA
GCACTGACTTTTTTGCGTACCCGCAGAAGGACATCAAGAAGCTGCTCGGCGGGAGCTATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCCGCCAGCTCCGTCCACGGCTTCACCGTCAAGGACGCAAGCGGCGAAGACGTGCACCTGAGCACCTTCAAGGGCAAGGTTCTCCTCATCGTCAACGTCGCATCACAGTGTGGC
CTGACCAACTCCAACTACACGGAGCTTGCCCAGCTACACGAGATGTACAAGGACCAGG
ATTTCGAGATCCTTGCGTTCCCGTGCAACCAGTTCGGCGGGCAGGAGCCCGGCACGAGCGAG
GAGATCGTCCAGCTCGTCTGCGCTCGCTTCAAGGCCAAGTACCCGATTCTTCACAAG
GTCGATGTGAACGGCGAGGACGCTGCGCCCATCTACAAGTTTCTGAAATCCAGCAAGACCGGC
CCCATGGGCGAAGACATCAAGTGGAACTTCGCCAAGTTCTTGGTGGACAGACAGGGGCATGTCGCCGAGCGGTATGCTCCGACCACCTACCCACTCAGCATCCAG
AAGGACATCAAGAAG
CTGCTCGGCGGGAGCTATTGA

Retrieve as FASTA