Entry information : ZmGPx02
Entry ID 5743
Creation 2007-08-17 (Christophe Dunand)
Last sequence changes 2007-08-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmGPx02
Name ZmGPx02
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Apical meristems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmGPx02
start..stop
S start..stop
SbGPx02 339 8e-122 1..170 1..170
OsGPx02 322 6e-115 1..170 1..169
HvGPx02 316 9e-113 1..167 1..166
NtGPx05-1A 281 3e-99 1..170 1..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 128177730..128177783 54 N° 2 128177538..128177614 77 N° 3 128177379..128177440 62 N° 4 128176248..128176366 119
N° 5 128175606..128175776 171 N° 6 128175478..128175507 30  
complement(join(128175478..128175507,128175606..128175776,128176248..128176366,1 28177379..128177440,128177538..128177614,128177730..128177783))


exon

Literature and cross-references ZmGPx02
Literature Chen,H.D., Zhang,X., Zhou,R.L., Arias L,A.C., Shendelman,J.M.,
Zazubovits,N., Borsuk,L.A., Emrich,S.J., Ashlock,D.A., Scanlon,M.J.and Schnable,P.S. Expressed Sequence Tags from B73 Maize Shoot Apical Meristems.
Protein ref. UniProtKB:   B6T5N2
DNA ref. GenBank:   AC204755 (50766..52787)
mRNA ref. GenBank:   EU960297
EST ref. GenBank:   DN222988
Cluster/Prediction ref. UniGene:   Zm.5695
Protein sequence: ZmGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   19144.75  
PI (pH):   %s   8.59
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAAESVPETSIHEFTVKDCNGKEVSLETYKGKVLLVVNVASKCGFTETNYTQLTELYQKYRDDFEILAFPCNQFLRQEPGTDQQIQDFACTRFKAEYPVFQVRVNGPDAAPVYKFLKASKPGLFGSSRIKWNFTKFLVDKDGKVIERYGTSTAPMAIEKDIQKALEE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, first exon is missing, 5 introns) and 74 ESTs. Cultivar="inbred B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGCGGCCGAATCCGTGCCGGAGACCTCCATACACGAATTCACCGTCAAGGTGCGGCGATCCCCATCCCGAGATCACGCTCCTGCGTGGTCCTGTTTGTATTTTTAGTTTCTTTTT
CTGATTTTTTTTCGCAAAAAGATAATTTTGGGGTTTATTCGTGGAGCAGGATTGCAACGGCAAGGAAGTGAGCCTGGAAACCTACAAGGGGAAGGTCCTCCTTGTTGTTAACGTCGCCTC
CAAATG
GTACGCTATCTTTCCCTGACAGTTGGAAGAATTTGTTCTTGGTATTCTCGTGGTTCGGGAGATGCTGAGACAGTTTTGATGTTCTCGATGCCGTCAGTGGGTTCACGGAGACCA
ATTACACGCAGCTGACGGAGCTTTATCAGAAGTACAGGGACAAAG
GTCTGTTCTTTGCCTGATGTGGTTCTTGATCTGTTGTTGCGCCTGAAATGTGAATCTCTCTGGAAGTTGGTGCGT
AGAAGTGGGTAATTGGAGTAGTGCACGTTGATGCTTGTTGGAACAGTGGTTCTTGTCTTCTGTTTGAAGTGGAATGGCAAAAAATCACGAAAAATATTCTCCTGAAAAAAGTGTGCGAGT
AGTCTTGCCCAAGGGAGATTTTACATTGCTTGCCACACAGCATTCATACCAAAAGCTTTGTTTACCTGTAGCTCATTTCTTCAACTATTTTCAGACATGCATGTGTTTTATGCAGCTTAG
ATTAGATAGGCAGCTGGTGAAGTGCGCATACAATTTCATTGCATTCGCTTATCAAATCTGAATGATCTCCCGTTTTCTGGAGTGCTTGGATAGTAGTTCTAACTTGCAGATACCTTTTGA
GGATCAGCGAAGGGTTCTGAAAGGAGCCTGTGAGAACCCTGTTTCCCAAAGAAGATGGTTTGTTTCCTTGAGGATTGTTTTCCCAAATTTCTTCGACAACTAAAATTAGCTTCCACCTAA
CATTTTCTGGCTCTCAGCCAACATTGCACTGTTTGGTGAAATTAAATAAAAATTGTATGACTGTTTGGCGAAATTAAATCAAAACTGTATGGAGTTTAAATGACGCTAGAATGATAATGT
TTTTCTTGCTACTAAGGCCGTCTGCAGTAGTCTATCCATAGTTTACCCAAAAACATTGTTTTGCACTGTAGACTGTATTGTTCGCAGAGTGGAGTTTAAATATAGGTATGGGGATGTGTA
AGCTACTTGAGATAGTCTAAGGCATCAAGTACTGTACCCACTTACACTTGCAGCAAATTTGCTCTGTTGTGAATTCAGTATATGGCTATCAAACAATCCCATTGTCTTTTGCAACTATGC
CTGTGTGTACTTTGATTCAGTCTGCGCTTGATATTCCATTGAAATGGTTTTATTCTCTAGATCTAACAGAAACTGATTTTACTTCCAATCTTGCTAGACTTCGAGATATTGGCATTCCCT
TGCAATCAGTTCTTGCGACAGGAGCCAGGTACTGATCAGCAGATACAAGACTTTGCTTGCACCAGATTTAAAGCTGAATACCCAGTTTTTCAGAAG
GTGAGAACTGTTTACCAGACTTGC
TAGCTTGCTAGGGAACTTTTGGTCCTTTTTCTTAGATAAGGTACTCTGAACAGTAGTCTCGTTTACCTGGCAGCTAGAATAATATTGGATATTACTTACGCTAATTTCTAGAAGATGCAA
AGATCGCATGGCAGAATACATCAATTTGGAAACTAACAACATGTGGTAGAAATACCCTTAGTCCTATAACTCGACGATGCGTTGTTATATTGGTTTTTAGTTGGCCACAATCAGACAAGT
TGCAGAAGCGTGTTTAAAGACGCAATCTGCATCTGCATCTCACCATCTAAAAAGTACGATTAATCAGCCATGGTGAGAATTTGCTGGCACGCGCATTGATATTTTGGATAGACCTGACAG
GTTGACATCAACGTGCAAACCGGAGCTGTGTGTTCTTATATTGCTAATTAAAGAAAGCTGATTGCATTCTAAACTCGGGTTTTGCAGGTGCGCGTAAACGGACCAGATGCGGCGCCGGTT
TACAAGTTTCTGAAAGCTAGCAAGCCTGGTTTGTTTGGGTCATCAAGGATCAAATGGAACTTTACCAAGTTTCTGGTGGACAAAGATGGGAAGGTCATCGAGAGATACGGAACCTCGACA
GCTCCAATGGCAATTGAG
GTCTCCTTCCCTCTCTGTCTCTGTCTCTCTCTCCCTCTCCAGACGTCTGCCTACGTTTTCTTTTTGATGCATGGATTCGTGTTTCTTCGACTCTGCAGAAGG
ACATCCAGAAGGCCCTTGAGGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGCGGCCGAATCCGTGCCGGAGACCTCCATACACGAATTCACCGTCAAGGATTGCAACGGCAAGGAAGTGAGCCTGGAAACCTACAAGGGGAAGGTCCTCCTTGTTGTTAACGTC
GCCTCCAAATG
TGGGTTCACGGAGACCAATTACACGCAGCTGACGGAGCTTTATCAGAAGTACAGGGACAAAGACTTCGAGATATTGGCATTCCCTTGCAATCAGTTCTTGCGACAGGAG
CCAGGTACTGATCAGCAGATACAAGACTTTGCTTGCACCAGATTTAAAGCTGAATACCCAGTTTTTCAGAAG
GTGCGCGTAAACGGACCAGATGCGGCGCCGGTTTACAAGTTTCTGAAA
GCTAGCAAGCCTGGTTTGTTTGGGTCATCAAGGATCAAATGGAACTTTACCAAGTTTCTGGTGGACAAAGATGGGAAGGTCATCGAGAGATACGGAACCTCGACAGCTCCAATGGCAATT
GAG
AAGGACATCCAGAAGGCCCTTGAGGAATAA

Retrieve as FASTA