Entry information : SbGPx02 (Sobic.001G365800.2 [2.1] / Sb01g034870 [1.4])
Entry ID 5745
Creation 2007-08-17 (Christophe Dunand)
Last sequence changes 2011-03-03 (Nizar Fawal)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-06 (Messaoudi)
Peroxidase information: SbGPx02 (Sobic.001G365800.2 [2.1] / Sb01g034870 [1.4])
Name (synonym) SbGPx02 (Sobic.001G365800.2 [2.1] / Sb01g034870 [1.4])
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Leaves
Ovaries
Roots
Inducers Acid treatment
Alkaline treatment
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value SbGPx02
start..stop
S start..stop
ZmGPx02 339 8e-122 1..170 1..170
OsGPx02 318 9e-114 1..170 1..169
HvGPx02 312 4e-111 1..167 1..166
ThasGPx04 274 3e-96 1..170 1..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58302312..58302365 54 N° 2 58302118..58302194 77 N° 3 58301958..58302019 62 N° 4 58300946..58301064 119
N° 5 58300312..58300482 171 N° 6 58300188..58300220 33  
complement(join(58300188..58300220,58300312..58300482,58300946..58301064,5830195 8..58302019,58302118..58302194,58302312..58302365))


exon

Literature and cross-references SbGPx02 (Sobic.001G365800.2 [2.1] / Sb01g034870 [1.4])
DNA ref. Phytozome 11:   chromosome_1 (58302365..58300188)
Cluster/Prediction ref. UniGene:   Sbi.15748
Protein sequence: SbGPx02 (Sobic.001G365800.2 [2.1] / Sb01g034870 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   19241.86  
PI (pH):   %s   9.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAAESVPETSIHEFTVKDCNGKEVSLETYKGKVLLVVNVASKCGFTEVNYTQLTELYRKYRDDFEILAFPCNQFLRQEPGSNQQIKDFACTRFKAEYPVFQVRVNGPDAAPVYKFLKASKPGLFGSARVKWNFTKFLVDKNGKVVERYGTSTAPMSIEKDIQKALDEE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 6 introns) and 13 ESTs
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGCGGCCGAGTCCGTGCCGGAGACCTCCATACACGAATTCACCGTCAAGGTGCGGCGATCCCCATCCCGAGATCACGCTCCTTATGCGTGGTGGTCCTGTTTGTTTTACTGTTTT
TCTCTCTCTCTCGCAAAACATAATTTTTTTGGGGATTTCTTCGCGGAGCAGGATTGCAACGGCAAGGAAGTGAGCCTGGAGACCTACAAGGGGAAGGTCCTCCTTGTTGTTAACGTCGCC
TCCAAATG
GTACGCTATCTTTCCCTGACTGTCGATAGGATTTGTTCTTTGTACTCTCCTGGTTCGTGAGATGATGAGACGGTGTTTGATGTTCTCGGTGCCGTCAGTGGGTTCACCGAGG
TTAATTACACGCAGCTGACGGAGCTTTATCGGAAGTACAGGGACAAAG
GTCAGTTCTTTTGCTTGCTCCTGTTCTTGATCTGTTGTTTGTGCTTGTTAATGGTATGAAATGTGAATCTCT
CTGGGGTTGGCGTGCACAAGTGGGTTCAACAAGTGTTCTAGTTAGAATTGGGGTAGTGCACGTTGATGCTCGTCGGAATAGTGGTTATTGTCTTCTGTTTGAATTGAAATTTCTGTTTGA
AGTGGAATGGCAAAAACACACACATAAATTTTCACCTGAAAAAAGTGTGGGATTAGTCTTGCCCAACGGAGATTTTACATTGTTTGCCACACAGCACTCATACCAAAAGCTTTGTTTACC
TGTAGATCATTTCTGCCACTGTTTTTCGACATGTATGGGTTTTATGCAGCTTACATTAGATAGGCAGCTGGTACAACATGCATACAATTTCATTGCATTCCCTTATCAAATCGGAGCGAT
CTTCCGTTTTCTGGAGTGCTTCTAACTTGCAGATACGTTTTGAGGATCAGCGAAGGGTTCTGAAAGGAGGCTGTGAGAACCCTGTTTTCCAAAGAAGATGTTTGTTTCCATGAGGATTGT
TTCCCCAAATTTCTTGGACAACTAAAATTAGCTTCAACTTAACATTTTCCTGACTGAGCCAATATGGGCACTGTTGAGTGAAATTAAATCAAAACTGCATGGAGTTTAAATGACGCTAGA
ATGATCACCATTTGTTGTTGCTTAAACATCAAGTATTGTACCCACTTACACTTGCAGCAAATTTGCTTTGTTTTAAGTTCAGTATATATGGCTATCAAGCAAGCCCATGTCTCTTGTGAC
TATGCCTCTGTACTTTGATTCAGTCTGTTCATGCTATTCCATTGAACTGATTTTTATTCTTTAGATCTAACAGAAACTGATTTTACTTCCAAACTTGTCAGACTTTGAGATATTGGCATT
CCCCTGCAATCAGTTCTTGCGACAAGAGCCAGGTTCTAATCAGCAGATAAAAGACTTTGCTTGCACCAGATTTAAAGCTGAATACCCAGTTTTTCAGAAG
GTGAGAACTGTTTGTCAGAC
ATGCTAGCTTGCTAAGAAACTTTTGATCCTTTTTCTGAGATAATGTCTTCTGAATACTCGTTTCATGTACCTAGTAGTTAGAATAATACTGGATATTCTTTATGCAAATTTCTAGATGAT
ACCGAAGACCACATGGCAGAATACATCAATTTGGAAACTAACGTCATGTGGTAGAAATAAACTCAGAACTTGACGATACATTGTTATATTGTTTTTTGTTATGCATAATCAGACAAGTTT
TAGTTGATTTGCACAAGCGTATTTACAGACGCAATCTACATCTGCATCTCACCATCTAAAAATACAAGTAATCAGCCATGGTGTGAAATTTGTTGGCATGCATATTGGTATTTGGATAGA
CCTGACAGGCTGACATCAACGTGCAAACCGTGTTCTTATGTTGCTATAAGAAAGCTGATTGCATTTTGAACTTGGGTTTGCAGGTGCGTGTAAATGGCCCGGACGCCGCGCCGGTTTACA
AGTTTCTGAAAGCTAGCAAGCCTGGTTTGTTTGGATCAGCAAGAGTCAAATGGAATTTTACCAAGTTTCTCGTGGATAAAAATGGGAAGGTCGTTGAGAGATACGGAACATCGACGGCTC
CAATGTCAATTGAG
GTCCCTCCCTCCTTCCCTCTCTCTGTCTCTGTCTCTCCCTTTTCAGACGTCTGCTTATTTTTGATGGATTGGTGTTTCTTCGACTTTGCAGAAGGACATCCAGAAG
GCCCTTGATGAGGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGCGGCCGAGTCCGTGCCGGAGACCTCCATACACGAATTCACCGTCAAGGATTGCAACGGCAAGGAAGTGAGCCTGGAGACCTACAAGGGGAAGGTCCTCCTTGTTGTTAACGTC
GCCTCCAAATG
TGGGTTCACCGAGGTTAATTACACGCAGCTGACGGAGCTTTATCGGAAGTACAGGGACAAAGACTTTGAGATATTGGCATTCCCCTGCAATCAGTTCTTGCGACAAGAG
CCAGGTTCTAATCAGCAGATAAAAGACTTTGCTTGCACCAGATTTAAAGCTGAATACCCAGTTTTTCAGAAG
GTGCGTGTAAATGGCCCGGACGCCGCGCCGGTTTACAAGTTTCTGAAA
GCTAGCAAGCCTGGTTTGTTTGGATCAGCAAGAGTCAAATGGAATTTTACCAAGTTTCTCGTGGATAAAAATGGGAAGGTCGTTGAGAGATACGGAACATCGACGGCTCCAATGTCAATT
GAG
AAGGACATCCAGAAGGCCCTTGATGAGGAATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCACGAGGTC CCCATTATTG CTGGAAAAAA AAGAACACGA GAAAAATCTA ATCCAAGAGA CGGGGATTCC AGAGCGCCCC CGCTCGGCTA GGGAAGGGAA GGAGAGGCGA AGCGGAGCGG  AGGCGAGATG GGGGCGGCCG AGTCCGTGCC GGAGACCTCC ATACACGAAT TCACCGTCAA GGATTGCAAC GGCAAGGAAG TGAGCCTGGA GACCTACAAG GGGAAGGTCC TCCTTGTTGT  TAACGTCGCC TCCAAATGTG GGTTCACCGA GGTTAATTAC ACGCAGCTGA CGGAGCTTTA TCGGAAGTAC AGGGACAAAG ACTTTGAGAT ATTGGCATTC CCCTGCAATC AGTTCTTGCG  ACAAGAGCCA GGTTCTAATC AGCAGATAAA AGACTTTGCT TGCACCAGAT TTAAAGCTGA ATACCCAGTT TTTCAGAAGG TGCGTGTAAA TGGCCCGGAC GCCGCGCCGG TTTACAAGTT  TCTGAAAGCT AGCAAGCCTG GTTTGTTTGG ATCAGCAAGA GTCAAATGGA ATTTTACCAA GTTTCTCGTG GATAAAAATG GGAAGGTCGT TGAGAGATAC GGAACATCGA CGGCTCCAAT  GTCAATTGAG AAGGACATCC AGAAGGCCCT TGATGAGGAA TAAAGATCCC ATGTCCTCTT GTCTCGTCTC ATCCATCACC CACACTGGCA GAAATAGGCA CTCGCAGAAG TATTCCGTCG  TAGCAACATT TGCTTGTTTG TAGTAAATCT GTATAATGCC CTCCTTTTCG CCTTCATGCT CATTGCGCTC GTGTAAGTAT TGGTTGTATT AACTAGCCAT TAATCTTCTC CGTCTTTTTT 
TTTCTTTTTG CCCTTTTTGG ACTGAAGAGT TAAGTCATGC TATATCGATG CAAAACTATG TAACATTGGT GAAGTATTAT ACTCCTACTA GTTTATAAGG TTTGTGTTTA CGCTC 

Retrieve as FASTA