Entry information : SbGPx04 (Sobic.010G067100.1 [2.1] / Sb10g005820 [1.4])
Entry ID 5746
Creation 2008-10-13 (Christophe Dunand)
Last sequence changes 2008-10-13 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-06 (Messaoudi)
Peroxidase information: SbGPx04 (Sobic.010G067100.1 [2.1] / Sb10g005820 [1.4])
Name (synonym) SbGPx04 (Sobic.010G067100.1 [2.1] / Sb10g005820 [1.4])
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Leaves
Seedlings
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbGPx04
start..stop
S start..stop
TaGPx04-1A 450 7e-164 1..232 1..229
ZmGPx04 429 2e-155 1..232 1..230
OruGPx04 350 3e-124 5..232 15..234
OsiGPx04 342 5e-121 2..232 8..232
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5288568..5288810 243 N° 2 5290232..5290308 77 N° 3 5290406..5290467 62 N° 4 5291280..5291398 119
N° 5 5291522..5291689 168 N° 6 5293042..5293071 30  
join(5288568..5288810,5290232..5290308,5290406..5290467,5291280..5291398,5291522 ..5291689,5293042..5293071)


exon

Literature and cross-references SbGPx04 (Sobic.010G067100.1 [2.1] / Sb10g005820 [1.4])
Literature Cordonnier-Pratt,M.-M., Gingle,A., Marsala,C. and Pratt,L.H. An EST database from Sorghum: light-grown seedlings.
DNA ref. Phytozome 11:   chromosome_10 (5288568..5293071)
Cluster/Prediction ref. UniGene:   Sbi.11252
Protein sequence: SbGPx04 (Sobic.010G067100.1 [2.1] / Sb10g005820 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   232
PWM (Da):   %s   24896.97  
PI (pH):   %s   9.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPAFTSLLPAATSAAAATASRLPSAAAGAASTFARLPHHPTGWAGASVAAPRTAAARRRAPGVAYATAATDKSIYDYTVKDIDGKDVPLKKFKNKVLLIVNVASQCGLTTANYTELSHIYEKYKTGFEILAFPCNQFGAQEPGSNTQIKQFACTRFKAEFPIFDVDVNGPNTAPIYKFLKSSAGGFLGDLVKWNFEKFLVDKNGKVIERYPPTTSPFQIEKDIQKLLAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 10, 5 introns) and 3 ESTs + 1 EST (BM330007, EL732359).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCCGCGTTCACTAGCCTCCTCCCCGCCGCGACCTCCGCCGCCGCCGCGACCGCCTCGCGGCTCCCCTCTGCCGCCGCCGGAGCGGCATCCACCTTCGCGCGTCTCCCGCATCAC
CCGACGGGCTGGGCTGGGGCCTCCGTCGCGGCGCCGCGTACGGCGGCGGCGCGCAGGCGGGCGCCCGGCGTCGCCTACGCCACCGCCGCCACCGACAAGAGCATCTACGACTACACCGTT
AAG
GTGGCCTCTTTTCTTCTGTTCTGCTGAGATTTCCGCTTGCCATGGCTCCGTGATATTATTTTTATTTTTATTTTTATTTTTATTTTTATTTTTATTTTTGCCCATAGCACCGTCTGA
TTCATTTAGACCCTGACTGTTTTTGTCTTGCTGCTTATTGCGCGCGGTTACTGTATTAGGTATCGAGGTGGTATTGTTGGGGTAGGTGGCCGGTGGGGGCGTTGCAACCATATACTGATT
GGTGTTTTAAGTGTTCCGTGACGCTGACTGTTATATTTGATAATTGGCTGGAACATCCATCACGTGAATGCTATTGAAGCGTTTACAATGTGTATGGCAACATTAGTATCACTAGGGTTG
CAATGTGTTGCGAATCGTAGAATGTGTTTGTGGAATTATGTGTCCTAACTCCTAAGGAGCTGTTGAGGTAGGCACAAATCCATGGGCGATACATTTTATGATATAATACATGTTTTATAT
TGTTGTTGAACTTGGCTGAAGTTGACCAAATCAGGTTGGCAGAGTTACGGCCAGTTTTGCAGATCAGATCCTTCTAAGGTTAGGTATCAAGGGCACAGAGTGTTGTAGCAGTAGACTGAA
TGATTCCCCATTCTTCTGAATTTTAAAGATGCAAAGCACACTGTGCTTGTTTTCCAACTACCATACCACATAAATTATAAAAATGGATATTGTCGTTTTTTTGGCATGTAATGGTAACCA
ACTAGATGATTTCCTGAACTTTCACAGAACACACCTCTTCTTTTTCAGATGCATGATTGTGGTAGAAATAAGTTTGCATCTGAGTCATGCTTTATGATGACAGTGTTAAACCCACCATGG
ATATTGCTGTTCAATAATATGTTCATTCATGTGCATATTTTCGATTGATTGAACATGTAAATATTTCTATTCATCCTTTCAACTGTATGTCTTTATTGGCAAATTTTTAAGGTGCATGCA
AAGTTTGAAGGTGGGTATTTTAAAACATTGTTTTTAGGATGCATCAGGAAATTCTTGTAGCACTAGACTTATTGGACCAGCTAACCAGCTATGGGCTAGTGAATTACTTAAAATAGCAGG
GTGGTTACCAGCTAACCAGCTATGGGCTAGTGAATGACTTAAAATAGCAGGGTGGTTAGTTGCAGAAATATCAAAATTGTACATGCAATACATGTTCAGGCAGGGTCACAGTGAAAATAA
GTAAAACAAAGAGAGCTTATTATGAGAAATTTTATGGGATACCATTTGTTTAGTGCTGAAATCTGAAGTTTGTGAATTTTAGGTTTCCCCAATGCTTTTCCTCCACATGTTGTAGTTTAT
TGGCATCTTACATACGGATACAGGAAGAAATAACTTTATTACTTTTACCTTAATAAGATCAAATATCTATGCACCTGTACCTGAAAGAATTATTCACTTTTCAGGACATTGATGGAAAAG
ATGTTCCTCTTAAAAAGTTCAAGAATAAGGTGTTGCTGATTGTTAACGTTGCTTCTCAATG
GTAATTTCATTGAAAAAAATCTTTCACTAACCACATTCTATGGTAATTTGTTTAGTATT
TTCTGGCATTTAACTTGGCATTCCTCTGTGAACCTCAGTGGGTTGACAACAGCAAATTACACTGAACTATCCCATATCTATGAGAAGTACAAGACTCAAGGTATGGCAATTTACACTGAA
CAATGTTGTGTATAGTGTATACTTATCATTTTAGGAAATCGAAACTAGACATTATACTTCCAATTAAAAGAGTCGCCAAAAGTTAAGTTGCTGTACCCTTTCAGTTGTACGTCTGATCCT
ACTTATCTCGTAAAACAACACAATGAAGACCAGCAGTTTCACTCTGATATACGCTATGTTTCTTGTTTATGCCACTTTGTGGGATCAGTCAATTAGGCCTCTTGTTTTTATGTAAGTGAC
CTTTTTGTTTGTCACATATATCCAGTACGCCTACTCTACTGGATCATCTCAATGCAGTTGCTGACTGTCCTGATTTCTTGTCTGAGTGGGCATAGGTCTAGCTGTCTAGGAGGTTAAAGG
TTTCTATTGCTTTTTGCAATATTTCTTGAGTCGTCATAAGTGAGTAGTTCTTGCTTAATATATCTGTGTGGGGGCAGACCCACATTGAACCAAGCCAGGGCACATGCCCACACTCATTTT
TCTGTTTCAGTGGACGTTGGGCCTTACTAAGGTAGTTGCAAAAGCGCAGTAGTTACCAGACCCCTGCTTGATTTTTGGGCTGATCCGCCCCTTAGTGTGTACAGCCATTCCAAATGTTGT
CCTTGTGAAGAGGATCCCCCCCTACTCTACAGTTAGTTCCAAAAGTGAACTTTAGAGTTTTGATGCACATTCTCCTCTGAGATACAGGAAAAGGAAATGTTGATGTTAGCACGAAGCCAT
GAACCTTGACTTCTTGGGTTAATAGTAGATTTGGCATCCTGCATTGTGTTTAATAGTTTATTTGACATGTAGGGTTTGAGATTCTGGCATTTCCTTGCAATCAATTTGGTGCACAAGAAC
CTGGATCAAATACTCAGATTAAGCAGTTTGCATGTACAAGATTCAAAGCTGAATTTCCTATTTTTGACAAG
GTATGGTAACTGCAGGCAGCTCAGTCCTCTGTTCCATAGTTTGTCCTGC
TTAACATTGTCTGACTTTACAAATAAAAAAATATCAGTGCATGATGTCTTTTGCTCTTCTTTCTACAATGTCAGGTTGATGTCAATGGACCTAATACAGCCCCCATCTATAAATTTCTGA
AGTCCAGTGCTGGAGGATTTTTAGGTGATCTAGTCAAGTGGAATTTTGAGAAGTTCTTAGTGGACAAGAATGGCAAAGTTATTGAGAGATATCCACCAACAACTTCACCATTCCAGATTG
AG
GTGCGTGATTACATCTCTAACTCACTACATCACACCTTTGTATATTCAGTCTATTTTTGGACTCTGTGTTACTCAAAATGAACATTTTCTTTTCCATATAGTTATAAAGGCTGATAGG
TACTTAATTAGGTGATGGGCACTTAATTACATATGCCTATGCAGTGCTATCAATCATTCCTTTCCCTATTAAGTAGTGATCTTGTGAGCATATCATGTGTCAATTAAGTGGAAGCATGTA
ATCATAATATTTATAACCTATGAAACATTTTTGAAGAATCAATGAAACTAAGAATTAAATCAATTGTATTTAATAAAAAAAGAATTAAATCAATTTGTCCTCCACAGCTGATTTTTATGT
AGTAAATTTGAAATAAAAGATAGAATGAAATAACAACCTGTGGACCCAATAATAGGTTTTGTGTACATCACGTTTAGGGATGATGACTTAGACGACCATCTTTTGGAGTGTCATTTAACA
TGTTTTGCTCATAAAGTTGCTTTAGTAGCCATCTTGAGGAATGGCATTTTAATTTTTTCTTGATGCTTGGTGCCTGGTACACCAATAGCACAGAAAGTACTTGATAGGTAGGCAACTAGG
GTGCCTGGTGCATCCACCTGAAATTAACCTTTTGTCACACGTACTGGGTTTCAATTGTTAAGTCTTTGGCCCTGCAAGGCTATGCCTATAATAGAGAGCTTCATATGGAATTTCCAGGTG
GCTCTAATAGTTCATGTTTGGCAGTGCTGACAAATAGAATGGCCCTATGAAAAGAATTTGTCAATGACAGTGCTAAGTTGTGAACTTGTGATAATACATGAGCTACGAGCACGCCAACGG
TGGGATTGTTTGGCTAAGAACTTTAGTTTTACTGTGATAGAGGCTTTTACTGATGTTCTGGAGCTCGCTTTGTCAAAAGAAGCATCCGGTACTGGTTTTGGTATAAAATATTCTCAAGTT
GCAGTAATGGATTAGTTTTCGACTTTCATCGTGTTTTGTGCTGTCATTTTGAAGTGGAAAGCGAGATCCCATCAGTTCTTTTTCCATTTATCTTACCATTCATTTGAGGAACAATTTTGC
TTTCAACCTGTTCTTCCTGTCACATTTCAGTGCATTAAGGCAGCTTTGGCACACAATCATTGGCTTTGAAATCTTTCGGTCGGTTTTAGTTTTAAAATGCCCACTCTTGTGTTTCAACGA
GTCGCACGTTCAACTGTCTTCTTGCGGTTATGATTCCTTAGGCCACTTGCTTAAGAAAGAAATCCAAAGCCTTAGCGCCGACCTCCCTGCGGTTTTCGGCTTTCATTACCATTCCACGTT
GCTCACAGCCTCCTTGCTATGAATTTTCTTGCAGAAGGACATCCAGAAACTCCTTGCGGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCCGCGTTCACTAGCCTCCTCCCCGCCGCGACCTCCGCCGCCGCCGCGACCGCCTCGCGGCTCCCCTCTGCCGCCGCCGGAGCGGCATCCACCTTCGCGCGTCTCCCGCATCAC
CCGACGGGCTGGGCTGGGGCCTCCGTCGCGGCGCCGCGTACGGCGGCGGCGCGCAGGCGGGCGCCCGGCGTCGCCTACGCCACCGCCGCCACCGACAAGAGCATCTACGACTACACCGTT
AAG
GACATTGATGGAAAAGATGTTCCTCTTAAAAAGTTCAAGAATAAGGTGTTGCTGATTGTTAACGTTGCTTCTCAATGTGGGTTGACAACAGCAAATTACACTGAACTATCCCATATC
TATGAGAAGTACAAGACTCAAG
GGTTTGAGATTCTGGCATTTCCTTGCAATCAATTTGGTGCACAAGAACCTGGATCAAATACTCAGATTAAGCAGTTTGCATGTACAAGATTCAAAGCT
GAATTTCCTATTTTTGACAAG
GTTGATGTCAATGGACCTAATACAGCCCCCATCTATAAATTTCTGAAGTCCAGTGCTGGAGGATTTTTAGGTGATCTAGTCAAGTGGAATTTTGAGAAG
TTCTTAGTGGACAAGAATGGCAAAGTTATTGAGAGATATCCACCAACAACTTCACCATTCCAGATTGAG
AAGGACATCCAGAAACTCCTTGCGGCATAA

Retrieve as FASTA