Entry information : PpaGPx02
Entry ID 5756
Creation 2007-08-20 (Christophe Dunand)
Last sequence changes 2007-08-20 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: PpaGPx02
Name PpaGPx02
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaGPx02
start..stop
S start..stop
PpaGPx01 282 2e-99 7..172 2..168
WnoGPx01 259 3e-89 3..172 73..241
OruGPx04 259 4e-89 3..172 64..232
AcvGPx06-2 256 4e-89 14..172 7..165
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 583514..583579 66 N° 2 584151..584227 77 N° 3 584404..584465 62 N° 4 584781..584899 119
N° 5 585011..585181 171 N° 6 585325..585354 30  
join(583514..583579,584151..584227,584404..584465,584781..584899,585011..585181, 585325..585354)


exon

Literature and cross-references PpaGPx02
Literature Fujita,T., Nishiyama,T., Shin-i,T., Kohara,Y. and Hasebe,M. Physcomitrella patens EST at a stage of the first asymmetric cell division of protoplasts.
DNA ref. Phytozome 11:   scaffold_115 (583514..585354)
EST ref. GenBank:   FC413638.1
Cluster/Prediction ref. UniGene:   Ppa.4093
Protein sequence: PpaGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   174
PWM (Da):   %s   19236.82  
PI (pH):   %s   7.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEPVNAAAQVQSGSSIYDFVVKDIDGNDVELSKYKGKVLLIVNVASACGLTTTNYTELAGIYSKYKNDFEILAFPCNQFGGQEPGSNAQIKQFACTRFKAEFPIFDVDVNGPQEAPVYKFLKSQKRGSILGDTIKWNFAKFLVDKNGNVVDRYAPTTPPSKIENDIQKYLRS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) aand 24 ESTs. Incorrect prediction fron Phytozome (first exon in missing) confirmed with ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCCCGTGAATGCTGCTGCCCAGGTGCAAAGTGGCAGCTCTATCTACGACTTCGTTGTAAAGGTATGGGTGTCGTTTTTCTTCTCCTTGTTAATTGAATGAGTGAGTCTCTCTTGG
CTGAATCGAATTTTAGCTTCATGTGGATCAATTACGTTCTTTCGCACTCCGAGCTTTGCATTTTTTGTTGGCGTTGGATGAAGAAGATGCTGCGTGTTGATTTCGGTTTTTAGTCTATCT
TTTTCCTTGTTTGATTGTTCTGTCAGCTGAAGTTGTACAACACTGGTAGAATATGCACTAGTTGTGTGAGGACGGTTTAGAACGTCGACTTTTCACGTTGTTAAGCGAATTTTTGGAGCA
TAAATGCGTAATGTAGACTGAGTTACGATTTTACAAAGTTCTCGAGTGGTTCAATTCTTTTTCTTTTTTTCTTTTCTTCCCTTTTAATTGGCTTCTATTCATTGAGGAAATTTTGTTTCA
GCTCGTCATCTCGAACCGATGTTCTCGTTTTCAAGTAGGGCACAGCACTGCGCCAGAGAATAACCGCATTTTATTGTAATCCTTGATAATACTGTGGCATTAACAACAACTGTAACAATT
ACAGTAACAATAACAATGCCCTCGTGAATGTGTGTAGGATATTGATGGGAACGATGTTGAGTTGAGCAAGTATAAAGGGAAGGTTTTGCTCATTGTCAACGTTGCTTCAGCATGGTAAGC
ATGTGCTCAGCTAATATCAACTTTGGGATCATTCATGTGTAAGATTTCAAAATTTTGTGCGAAATGTAGTGCAATGATTTTATTAATGAGAAAGCTTGGTATTTGTCTACTATTGTAATT
CACAAGAGTAACAAATCTCAATTATTGCCATGATATGGATGGGTATGCAGTGGATTGACGACCACGAACTATACGGAGCTTGCGGGCATTTACTCCAAGTACAAGAATCAAGGTGAGCGG
ATGTTCACCACTCTGGACTCAAAACCTTAAATGTCGACAGGGCATCCACTTTATTTGCTGGAAATTAGTAATTGCTACTCGCTTTTGATCTCTTCTGGCCTATTATCCCTCCCAAAAAGA
GTCTCTTAGTGACATGTCACTCCTCATGAAGATTACTTTTAGTCTGAATTGCTAGATATCTCATTTTCAAGGTAATGGTACGATTTGCGTTTTGAGCGTGTTCTTCGCACTCATGACGAC
CGTAAGGGTTGGCTGTTAAAATTTGTCTGCTGAGTTGCTGCCCACACTGTGTTTTTGAGACGTGCAGATTTTGAGATTTTGGCTTTCCCCTGCAATCAATTTGGAGGTCAGGAGCCCGGT
TCAAATGCACAGATCAAGCAATTCGCTTGCACAAGGTTCAAAGCCGAGTTCCCCATTTTTGACAAG
GTAACACCCCCACTTTTCTGATCCGCAGACGCCTAGTTTTACAGATGCCTGTAC
TCTCCTGCTTTGTATCCTTGGTGTATGAGACTGACTGGCATATTGTTGTCCTTGCAGGTGGACGTTAATGGTCCTCAGGAGGCGCCCGTTTACAAGTTCCTGAAGTCTCAGAAGAGAGGC
AGCATTCTGGGAGACACCATCAAGTGGAATTTTGCAAAATTCCTTGTTGACAAGAACGGGAATGTCGTCGATCGCTATGCACCCACCACTCCACCATCAAAGATAGAG
GTAGTCTTCCTC
TCCCAGAGTTATTATCATCTGTATGTTTTAAATAATGAAATTTTATGAAGGCGTCGCAACTGTCGTTGACTTCATGAATCATTGCCGTATGCTGAAACGATGGTGCTGTGGCGTCTTTTC
GAGTTGTCCAGAACGACATCCAGAAATACCTGAGAAGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCCCGTGAATGCTGCTGCCCAGGTGCAAAGTGGCAGCTCTATCTACGACTTCGTTGTAAAGGATATTGATGGGAACGATGTTGAGTTGAGCAAGTATAAAGGGAAGGTTTTGCTC
ATTGTCAACGTTGCTTCAGCATG
TGGATTGACGACCACGAACTATACGGAGCTTGCGGGCATTTACTCCAAGTACAAGAATCAAGATTTTGAGATTTTGGCTTTCCCCTGCAATCAATTT
GGAGGTCAGGAGCCCGGTTCAAATGCACAGATCAAGCAATTCGCTTGCACAAGGTTCAAAGCCGAGTTCCCCATTTTTGACAAG
GTGGACGTTAATGGTCCTCAGGAGGCGCCCGTTTAC
AAGTTCCTGAAGTCTCAGAAGAGAGGCAGCATTCTGGGAGACACCATCAAGTGGAATTTTGCAAAATTCCTTGTTGACAAGAACGGGAATGTCGTCGATCGCTATGCACCCACCACTCCA
CCATCAAAGATAGAG
AACGACATCCAGAAATACCTGAGAAGTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCTTGTCTCG AGGAATGCCC GCGTCGTCTC TTCGTCTCCC CTTCCCCATC CTCTGACATG GCCCTCTTCG TTGCTGCGTC GTCTTCCTCT CTCCCCTCTG CCCTCTCGCG TCTGCACTTT  TGCTCCTCAA ATCTGCCCAA GAACGTCGCG GCTTTTGCGT TCTCTCACCG CGCCACTGCT TCTTTTGCCT CCAGCTCTGT ATTTGGCAGG CGTCTTGTTG GGTCGTTGGT AGGGTTCACT  CTGGGGAACG CTGCCTCCTC CACCTGTGTA CGAGGCATGG AGCCCGTGAA TGCTGCTGCC CAGGTGCAAA GTGGCAGCTC TATCTACGAC TTCGTTGTAA AGGATATTGA TGGGAACGAT  GTTGAGTTGA GCAAGTATAA AGGGAAGGTT TTGCTCATTG TCAACGTTGC TTCAGCATGT GGATTGACGA CCACGAACTA TACGGAGCTT GCGGGCATTT ACTCCAAGTA CAAGAATCAA  GATTTTGAGA TTTTGGCTTT CCCCTGCAAT CAATTTGGAG GTCAGGAGCC CGGTTCAAAT GCACAGATCA AGCAATTCGC TTGCACAAGG TTCAAAGCCG AGTTCCCCAT TTTTGACAAG  GTGGACGTTA ATGGTCCTCA GGAGGCGCCC GTTTACAAGT TCCTGAAGTC TCAGAAGAGA GGCAGCATTC TGGGAGACAC CATCAAGTGG AATTTTGCAA AATTCCTTGT TGACAAGAAC  GGGAATGTCG TCGATCGCTA TGCACCCACC ACTCCACCAT CAAAGATAGA GAACGACATC CAGAAATACC TGAGAAGTTA GGCGTAATTA GTTCGGTTGA AGGGCATGGC GACGGGAGTT  AACGGTATTA CGCCCTGTGA TTTATTTCTA CTTTCCGGAA ACCGTGGAAT ATTTAGTCTT GCTATTGGCT TGTTCTCAAA ATGTTAGATT GTATTACCAA ATCCATTTTT GCCTCTAAAC 
CTTCCAGCTA AATTATTTTT ATCAACTAGT GGAGCAGTTA TCAGCTCAAA GAAGAAACAT ATTTCACCTG TATTTCATTC TATCTTTTAA AAAATGCG 

Retrieve as FASTA