Entry information : UmGPx ( GPX2)
Entry ID 5768
Creation 2007-08-24 (Christophe Dunand)
Last sequence changes 2011-11-30 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-20 (Christophe Dunand)
Peroxidase information: UmGPx ( GPX2)
Name (synonym) UmGPx ( GPX2)
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Ustilaginomycetes Ustilaginaceae Ustilago
Organism Ustilago maydis    [TaxId: 5270 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value UmGPx
start..stop
S start..stop
SreGPx 313 7e-112 1..161 1..161
UhorGPx01 310 1e-110 1..161 1..161
MresGPx01 230 5e-79 1..159 1..159
RsolGPx01 229 1e-78 1..159 1..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 84731..84982 252 N° 2 85075..85192 118 N° 3 85300..85415 116  
join(84731..84982,85075..85192,85300..85415)


exon

Literature and cross-references UmGPx ( GPX2)
Literature Birren et al., The genome sequence of Ustilago maydis
Protein ref. UniProtKB:   A0A0D1E3D8
DNA ref. JGI genome:   contig_1_68 (84731..85415)
Cluster/Prediction ref. Genebank:   23562685
Protein sequence: UmGPx ( GPX2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   161
PWM (Da):   %s   17847.94  
PI (pH):   %s   5.32
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSFYDLKAKKPSQEDYTFDQLKGKVVLVVNTASKCGYTPQFAELEELNKKYADQGLQIIGFPCNQFAGQDPGSDESIGEFCQRNYGVTFPMMAKSDVNGSNTNEVFQFLKKEKAGILGTEMIKWNFTKFLIDKEGNVIERYGSNTKPSAIAPAIEKLLSQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 2 introns), 1 mRNA and 10 ESTs. Strain="521".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTCATTCTACGATCTCAAGGCCAAAAAGCCCAGCCAGGAGGACTACACCTTTGATCAACTCAAAGGCAAAGTCGTTCTAGTTGTCAACACCGCCTCCAAGTGCGGATATACTCCC
CAGTTTGCTGAGCTTGAGGAGCTCAACAAAAAGTACGCTGACCAGGGTCTGCAGATCATTGGGTTCCCTTGCAACCAGTTTGCTGGTCAAGATCCAGGGAGCGATGAATCCATCGGCGAG
TTCTGCCAACGT
GTAAGTGAACATGCTTTGCAAGAAGCGGATTGGTCCTAAGCAGCACTCTGACAGAGCGCACCCTTTGCCTTTTTTTTCGTGTGGGTTGGTAGAACTACGGTGTAACTT
TCCCGATGATGGCCAAATCCGATGTCAACGGCAGTAACACCAACGAGGTCTTCCAGTTCCTCAAGAAGGAAAAGGCTGGCATTCTTGGTACCGAGATGATCA
GTATGCATCCCCCCCCTC
CTTTCATCGTCGTTTCTTCTGATTCTGCGAGCAAGCTACTGACCATCGGCTGCTTCGGCACACGTCTCGCGCTGCTTTTGTATGCACAGAGTGGAACTTCACCAAATTCCTTATCGACAA
GGAGGGTAACGTCATTGAGCGATATGGATCCAACACCAAACCATCGGCCATCGCACCCGCCATCGAGAAGCTTCTCTCCCAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTCATTCTACGATCTCAAGGCCAAAAAGCCCAGCCAGGAGGACTACACCTTTGATCAACTCAAAGGCAAAGTCGTTCTAGTTGTCAACACCGCCTCCAAGTGCGGATATACTCCC
CAGTTTGCTGAGCTTGAGGAGCTCAACAAAAAGTACGCTGACCAGGGTCTGCAGATCATTGGGTTCCCTTGCAACCAGTTTGCTGGTCAAGATCCAGGGAGCGATGAATCCATCGGCGAG
TTCTGCCAACGT
AACTACGGTGTAACTTTCCCGATGATGGCCAAATCCGATGTCAACGGCAGTAACACCAACGAGGTCTTCCAGTTCCTCAAGAAGGAAAAGGCTGGCATTCTTGGTACC
GAGATGATCA
AGTGGAACTTCACCAAATTCCTTATCGACAAGGAGGGTAACGTCATTGAGCGATATGGATCCAACACCAAACCATCGGCCATCGCACCCGCCATCGAGAAGCTTCTCTCC
CAGTGA

Retrieve as FASTA