Entry information : GzGPx
Entry ID 5771
Creation 2007-08-24 (Christophe Dunand)
Last sequence changes 2012-04-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-06 (Christophe Dunand)
Peroxidase information: GzGPx
Name GzGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella zeae (anamorph Fusarium graminearum)    [TaxId: 5518 ]
Cellular localisation N/D
Tissue type N/D
Inducer Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value GzGPx
start..stop
S start..stop
FoGPx01 356 2e-126 13..246 1..241
GmoGPx01 347 2e-122 66..246 63..243
NhaeGPx01 337 8e-119 36..246 37..247
CgraGPx01 316 1e-110 67..243 60..236
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4466742..4467009 268 N° 2 4466156..4466628 473  
complement(join(4466156..4466628,4466742..4467009))


exon

Literature and cross-references GzGPx
Literature Birren,B., et al., The Broad Institute Genome Sequencing Platform. Genome Sequence of Fusarium graminearum (Gibberella zeae).
DNA ref. JGI genome:   Supercontig_3.3 (4467009..4466156)
EST ref. GenBank:   CN813131.1 [5' end]   BU064942.1 [3' end]
Cluster/Prediction ref. JGI gene:   7121 [Incorrect prediction]
Protein sequence: GzGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   246
PWM (Da):   %s   27560.9  
PI (pH):   %s   9.49
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLSRPLSISMSMPMWRAPLWSRFAVNNLQPSSSSSSLINKYSCATIHFTRSSSPPFPSLNNQRLYHRNYTTTSNMASATSFYDFKPLDKRGQEVPLADYKGKVVLIVNTASKCGFTPQYAGLEKLWTDLKGKYPDDFVILGFPCNQFGGQEPGTDDDIQEFCQLNYGVTFPIMQKTEVNGDGTNPLWVWLKDQQSGLLGLKRIKWNFEKFLVGRDGKVKGRWASTTKPESLEKPILEALAEKPAA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 1 introns) and 8 ESTs. Strain="PH-1; NRRL 31084".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCTGTCCCGGCCCCTGTCCATATCCATGTCCATGCCCATGTGGCGTGCTCCTCTTTGGTCCAGATTTGCAGTCAACAATTTGCAACCATCATCATCAAGTTCCAGCCTTATTAAT
AAATACTCTTGCGCAACCATCCACTTTACTCGTTCCAGTTCCCCGCCATTTCCATCTCTCAACAATCAAAGACTTTACCACAGAAATTATACAACAACATCCAACATGGCCTCTGCTACT
AGCTTTTACGACTTTAAGCCGCTTGACA
GTATGTCCCTCTCTGCCCCTCCTCTCTCTGTCCATATATATTCATACCCCGCCTTGAAACACACCACTTCATTCATGGCAAATAGACTCACC
CAACTAACTCAATCCTCTCAGAGCGCGGCCAGGAGGTTCCCCTCGCCGACTACAAGGGCAAGGTCGTCCTCATTGTCAACACTGCCTCCAAGTGCGGCTTCACCCCTCAGTACGCCGGTC
TTGAGAAGCTCTGGACCGACCTCAAGGGCAAGTACCCCGATGACTTTGTCATCCTCGGCTTCCCCTGCAATCAGTTCGGCGGCCAGGAGCCCGGCACCGACGATGACATTCAGGAGTTCT
GCCAGCTCAACTACGGCGTGACCTTCCCCATCATGCAAAAGACCGAGGTCAACGGTGACGGCACCAACCCTCTCTGGGTCTGGCTCAAGGACCAGCAGTCCGGTCTTCTCGGCCTCAAGC
GCATCAAGTGGAACTTTGAGAAGTTCCTCGTCGGCCGTGATGGAAAGGTCAAGGGTCGATGGGCCAGCACCACCAAGCCTGAGAGTCTTGAGAAGCCCATTCTCGAGGCCCTTGCTGAGA
AGCCTGCGGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCTGTCCCGGCCCCTGTCCATATCCATGTCCATGCCCATGTGGCGTGCTCCTCTTTGGTCCAGATTTGCAGTCAACAATTTGCAACCATCATCATCAAGTTCCAGCCTTATTAAT
AAATACTCTTGCGCAACCATCCACTTTACTCGTTCCAGTTCCCCGCCATTTCCATCTCTCAACAATCAAAGACTTTACCACAGAAATTATACAACAACATCCAACATGGCCTCTGCTACT
AGCTTTTACGACTTTAAGCCGCTTGACA
AGCGCGGCCAGGAGGTTCCCCTCGCCGACTACAAGGGCAAGGTCGTCCTCATTGTCAACACTGCCTCCAAGTGCGGCTTCACCCCTCAGTAC
GCCGGTCTTGAGAAGCTCTGGACCGACCTCAAGGGCAAGTACCCCGATGACTTTGTCATCCTCGGCTTCCCCTGCAATCAGTTCGGCGGCCAGGAGCCCGGCACCGACGATGACATTCAG
GAGTTCTGCCAGCTCAACTACGGCGTGACCTTCCCCATCATGCAAAAGACCGAGGTCAACGGTGACGGCACCAACCCTCTCTGGGTCTGGCTCAAGGACCAGCAGTCCGGTCTTCTCGGC
CTCAAGCGCATCAAGTGGAACTTTGAGAAGTTCCTCGTCGGCCGTGATGGAAAGGTCAAGGGTCGATGGGCCAGCACCACCAAGCCTGAGAGTCTTGAGAAGCCCATTCTCGAGGCCCTT
GCTGAGAAGCCTGCGGCTTAA

Retrieve as FASTA