Entry information : CnGPx01_JEC21
Entry ID 5775
Creation 2007-08-30 (Christophe Dunand)
Last sequence changes 2012-05-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-23 (Christophe Dunand)
Peroxidase information: CnGPx01_JEC21
Name CnGPx01_JEC21
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3005]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CnGPx01_JEC21
start..stop
S start..stop
CnGPx01_H99 310 4e-111 1..151 1..151
CgaGPx01 307 5e-110 1..151 1..151
DcryGPx01 280 3e-99 1..151 1..151
TmesGPx01_Fries 254 7e-89 1..151 1..151
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 91931..91954 24 N° 2 91780..91861 82 N° 3 91625..91713 89 N° 4 91469..91555 87
N° 5 91310..91393 84 N° 6 91194..91259 66 N° 7 91100..91123 24  
complement(join(91100..91123,91194..91259,91310..91393,91469..91555,91625..91713 ,91780..91861,91931..91954))


exon

Literature and cross-references CnGPx01_JEC21
Literature Fung E., Hyman R.W., Rowley D., Bruno D., Miranda M., Fukushima M., Wickes B.L., Fu J., Davis R.W. Cryptococcus neoformans serotype D sequencing.
Protein ref. GenPept:   AAW47014.1 UniProtKB:   Q5K7D6
DNA ref. JGI genome:   NC_006683 (91954..91100)
Protein sequence: CnGPx01_JEC21
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   151
PWM (Da):   %s   16750.47  
PI (pH):   %s   5.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSDIYSYSVEFPKSTLPLSDLKGKTLLFVNVASKCGLTPQYKDLQALHEKYGDKGLAIIGFPCNFKAQEPGTDDEVLQFCQVNYGVTFPIAKKGDVNGENTQPIWKYLKENAEPPVSDIDWNFSKFLVKDGKITWFPARSTKVSDVEAAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 14, 6 introns). No EST. Strain="JEC21" and "B-3501A".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGATATCTACTCTTACTCTGTGAGTTTCCAGTTCCAACACTTTCCGTGTGCTTCTTTACCTGGATATCCGACTGATGAACACGGGCAGGTTGAGTTTCCCAAGTCCACTCTTCCC
CTTAGTGACCTGAAGGGCAAGACTCTCTTGTTCGTCAACGTTGCGAGCAAGTGCG
GTTAGTTTCATTCTTTCCTAGGAAGTGATCTGTGGTTCACGGCTGATGAATTGTATCTTCTCATA
GGTTTGACTCCTCAGTACAAGGATCTTCAAGCTTTGCACGAGAAGTACGGTGATAAGGGGCTGGCGATCATTGGTTTCCCTTGCAACCAGGTAAGCGTTTATGTTTGACGTTGGATTGAA
GTCGAGAGATGGCGAGCGACTGATCCGTTTGGCGATTAGTTTAAGGCTCAAGAGCCTGGGACCGATGATGAGGTTCTTCAGTTCTGTCAAGTCAACTATGGAGTGACTTTCCCTATTGCT
AAGAAG
GTATGTATTGTTTTAGTTTTACGCTGGTAATGGATAGTACAAAGCTTGTATATTAATTTAATTTTTTCTTGTTAGGGCGACGTTAATGGCGAAAACACTCAGCCTATCTGGAAA
TACCTCAAAGAGAATGCCGAGCCCCCTGTCTCTGACATCGACTGG
GTACGTCTATTTTTTATGTAAAGCGAGTGTAGGGGGTTGATAGTCTTCAGAACTTTTCCAAGTTCCTTGTCAAGG
ATGGAAAGATCACTTGGTTCCCTGCCCGAAGCACCAAGGTT
GTAAGTACCATCCCTCCATCCTTAACTCCTCATGGTAGCCAAAGCTGACTCGACAACTTTGTGGATGCAGAGCGATGTT
GAGGCTGCTCTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGATATCTACTCTTACTCTGTTGAGTTTCCCAAGTCCACTCTTCCCCTTAGTGACCTGAAGGGCAAGACTCTCTTGTTCGTCAACGTTGCGAGCAAGTGCGGTTTGACTCCTCAG
TACAAGGATCTTCAAGCTTTGCACGAGAAGTACGGTGATAAGGGGCTGGCGATCATTGGTTTCCCTTGCAACCAG
TTTAAGGCTCAAGAGCCTGGGACCGATGATGAGGTTCTTCAGTTC
TGTCAAGTCAACTATGGAGTGACTTTCCCTATTGCTAAGAAG
GGCGACGTTAATGGCGAAAACACTCAGCCTATCTGGAAATACCTCAAAGAGAATGCCGAGCCCCCTGTCTCTGACATC
GACTGG
AACTTTTCCAAGTTCCTTGTCAAGGATGGAAAGATCACTTGGTTCCCTGCCCGAAGCACCAAGGTTAGCGATGTTGAGGCTGCTCTTTGA

Retrieve as FASTA