Entry information : CnGPx02_JEC21
Entry ID 5776
Creation 2007-08-30 (Christophe Dunand)
Last sequence changes 2007-08-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: CnGPx02_JEC21
Name CnGPx02_JEC21
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CnGPx02_JEC21
start..stop
S start..stop
CnGPx02_grubiiH99 370 2e-133 1..185 1..185
CgaGPx02 361 4e-130 1..185 1..185
DcryGPx02 278 5e-97 11..185 7..183
DcryGPx03 276 1e-96 11..185 7..183
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 156088..156210 123 N° 2 155972..156021 50 N° 3 155760..155901 142 N° 4 155536..155672 137
N° 5 155352..155457 106  
complement(join(155352..155457,155536..155672,155760..155901,155972..156021,1560 88..156210))


exon

Literature and cross-references CnGPx02_JEC21
Literature Fung E., Hyman R.W., Rowley D., Bruno D., Miranda M., Fukushima M., Wickes B.L., Fu J., Davis R.W. Cryptococcus neoformans serotype D sequencing.
Protein ref. GenPept:   AAW43465.1 UniProtKB:   Q5KHB8
DNA ref. JGI genome:   NC_006687 (156210..155352)
Cluster/Prediction ref. UniGene:   Fne.1360
Protein sequence: CnGPx02_JEC21
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   185
PWM (Da):   %s   20098.21  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFFDSIASKFGYESLPGDVANKSFYDLKAKLPGSKGDLDFSTLKGKVVLIVNTASKCGFTPQYTGLEELHKTYGDKGLVVLGFPSNEFGGQEPGSDDDIAQFCLNHGVTFPLMKKSEVNGKNMNEVFAWLKSQKGENVGGLAGTTAIKWNFTKFLINKEGKCVGRYGSSTKPEKLKEEIEKLL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 4 introns) and 3 ESTs. Strain="JEC21" and "B-3501A".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGTTTTTCGACAGCATCGCCTCCAAGTTTGGTTACGAATCTCTCCCAGGGGACGTTGCCAACAAAAGCTTCTACGATTTGAAAGCCAAGCTGCCTGGGAGCAAGGGTGATTTGGAC
TTT
GTAAGTACTCCTTTTTTTCATCGTATCATCCGGATAAGGGAATAAGTATTGATAGAGTCTGTGCAGTCTACTTTGAAAGGCAAGGTTGTGTTGATCGTCAACACTGCTTCCAAATGG
CAAGTCTTTTCCTTTACAAACATCCGTTGAAACCAGTATAAGATCTGACTTGTGCTTTGGTGTGTGTAGTGGTTTCACTCCCCAGTATACCGGCCTTGAAGAGCTCCACAAGACTTATGG
AGATAAGGGTCTCGTCGTCCTTGGTTTCCCTTCCAACGAGTTTGGAGGACAAGAGCCTGGCTCTGACGATGATATCGCCCAGTTTTGTACC
GTGAGTCATCAGTCATTCTCCCGCCACAT
CTCGCCTTTCGACGTATGATCCAGTGGGTAATGACTGACATCAAACCGTTTATTGTAGCTCAACCACGGTGTCACTTTCCCGCTTATGAAGAAGTCTGAAGTGAACGGAAAGAACATGAA
TGAGGTCTTTGCGTGGTTGAAGTCTCAGAAGGGAGAGAATGTTGGTGGTCTTGCCGGGACCACTGCTATCAAGTG
GTACGTCCGTGCTTCCTTTTTTTCCTTTGAAAACATACTGCCATA
TCAGTCAGAGTTGACATCCGAGTTTTTGCATAGGAACTTTACCAAATTCCTTATCAACAAGGAGGGCAAGTGTGTCGGCCGATATGGCTCTTCCACCAAGCCCGAGAAGCTCAAGGAGGA
AATCGAGAAGCTTCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGTTTTTCGACAGCATCGCCTCCAAGTTTGGTTACGAATCTCTCCCAGGGGACGTTGCCAACAAAAGCTTCTACGATTTGAAAGCCAAGCTGCCTGGGAGCAAGGGTGATTTGGAC
TTT
TCTACTTTGAAAGGCAAGGTTGTGTTGATCGTCAACACTGCTTCCAAATGTGGTTTCACTCCCCAGTATACCGGCCTTGAAGAGCTCCACAAGACTTATGGAGATAAGGGTCTCGTC
GTCCTTGGTTTCCCTTCCAACGAGTTTGGAGGACAAGAGCCTGGCTCTGACGATGATATCGCCCAGTTTTGTACC
CTCAACCACGGTGTCACTTTCCCGCTTATGAAGAAGTCTGAAGTG
AACGGAAAGAACATGAATGAGGTCTTTGCGTGGTTGAAGTCTCAGAAGGGAGAGAATGTTGGTGGTCTTGCCGGGACCACTGCTATCAAGTG
GAACTTTACCAAATTCCTTATCAACAAG
GAGGGCAAGTGTGTCGGCCGATATGGCTCTTCCACCAAGCCCGAGAAGCTCAAGGAGGAAATCGAGAAGCTTCTTTAA

Retrieve as FASTA